KEGG   Paenibacillus sp. FSL R5-0912: R50912_03250Help
Entry
R50912_03250      CDS       T03334                                 

Definition
(GenBank) glutamate-1-semialdehyde aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
paeq  Paenibacillus sp. FSL R5-0912
Pathway
paeq00860  Porphyrin and chlorophyll metabolism
paeq01100  Metabolic pathways
paeq01110  Biosynthesis of secondary metabolites
paeq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:paeq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    R50912_03250
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:paeq01007]
    R50912_03250
Enzymes [BR:paeq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     R50912_03250
Amino acid related enzymes [BR:paeq01007]
 Aminotransferase (transaminase)
  Class III
   R50912_03250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AIQ39173
UniProt: A0A089JX23
Position
complement(708164..709489)
Genome map
AA seq 441 aa AA seqDB search
MNRSTSEHLYQEALQHIVGGVNSPSRSFKAVGGGAPVFMKRARGARFWDEDGNEYIDYLA
AYGPIITGHAHPHITAAITEAAQNGLLYGTPTQLEIRLAKMLKEAIPSMDKVRFVNSGTE
AVMTTIRVARAYTKRSKIIKFAGCYHGHSDLVLVAAGSGPSTLGIPDSAGVPASIAQEVI
TVPFNDLDGLREALEQWGEDVAAVMVEPIVGNFGMVMPHPGFLEGLCKLTHENGSLVIYD
EVITAFRFHYGSTQTYAGLEGHEDIIPDLTALGKIIGGGLPIGAYGGRKHVMEQVAPLGP
AYQAGTMAGNPASISAGIACLEVLSAEGVYNEMERLAIRLTEGLQESAGRHGIPLTINRI
RGAFSTHFCSHPITNYDEAQDTDGEMFASFFRHMLNRGINLAPSKYEAWFLTTAHTDADI
DITLEAAEASFSAMAAEQQQL
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcagcacatcagaacatttataccaggaagctctgcagcatatcgttggaggc
gtcaacagcccctcccgttccttcaaggccgtaggcggtggtgcccccgtattcatgaaa
cgcgcaagaggcgcccgcttctgggacgaggacggcaatgaatatattgattatctggcc
gcctatggcccgatcattaccggacatgcccacccgcatatcaccgctgccattacagag
gctgcacagaacggactgctctatggcacgccgacccagcttgaaatcaggctggccaaa
atgctgaaggaagctatcccctccatggacaaggtacgcttcgtcaactccggtacagaa
gccgtcatgacaacgatccgagtagcacgcgcctacacgaagcgcagcaagattatcaag
ttcgcaggctgctaccacggccactctgatcttgtgcttgtagctgcaggctctggaccg
tctacgctgggcatcccggacagtgcaggcgttccggccagcatcgcccaggaagtcatc
actgtacccttcaatgatctggacgggctacgcgaggcgcttgagcagtggggtgaagat
gtggctgccgttatggtcgagccgattgtcggtaacttcggcatggtcatgccgcatcct
ggtttcctcgaaggcctgtgcaagctgacgcatgagaacggctcgcttgtcatttacgat
gaggtcatcaccgctttccgtttccattacggctccacccagacttatgcaggtcttgag
ggccatgaggatatcattcccgatctgaccgcactgggcaaaatcatcggcggcgggctg
cctatcggcgcttacggcggacgtaagcatgtcatggagcaggtcgctccgctgggtccg
gcatatcaggccggaacgatggctggtaacccagcctcgatctcggctgggattgcctgc
cttgaggtgctgagtgccgagggtgtctataatgagatggaacggctcgctatccgcctg
accgaagggctgcaggaatctgccggacggcacggtattccattgaccatcaaccggata
cgcggtgcattctctacgcatttctgtagccatccgattaccaattatgatgaagcgcag
gataccgacggtgaaatgttcgccagcttcttccgccatatgctgaaccgcggcattaat
ctggcgccttccaaatatgaagcgtggttcctgaccactgcccatacggacgccgacatc
gatattacgctggaggcagcagaggcctcgttctcggctatggcggcggagcagcaacag
ctgtaa

DBGET integrated database retrieval system