KEGG   Paenibacillus sp. FSL R5-0912: R50912_07105Help
Entry
R50912_07105      CDS       T03334                                 

Definition
(GenBank) nucleoid-structuring protein H-NS
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
paeq  Paenibacillus sp. FSL R5-0912
Pathway
paeq00360  Phenylalanine metabolism
paeq00362  Benzoate degradation
paeq00622  Xylene degradation
paeq01100  Metabolic pathways
paeq01120  Microbial metabolism in diverse environments
paeq01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:paeq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    R50912_07105
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    R50912_07105
   00622 Xylene degradation
    R50912_07105
   00621 Dioxin degradation
    R50912_07105
Enzymes [BR:paeq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     R50912_07105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like
Motif
Other DBs
NCBI-ProteinID: AIQ39825
UniProt: A0A089JWE1
Position
1573554..1574516
Genome map
AA seq 320 aa AA seqDB search
MVKTNQSKIVDCTIRDGGLVNNWDFSIEFVQKLYAGLNEAGVDYMEIGYKNSPKLLKGSE
GAGPWRFLNDDFLRKVIPQKGHTKLSALVDIGRVDVNDILPRSESMLDLIRVACYSKDVD
KALELVQTFHDLGYETTINIMALSNVMENELLEAFEQIRESVVDVVYIVDSYGSLDHNDI
HYLVEKFRTHLPDKRLGVHTHNNLQLAFSNTLIAAEKGVELLDASCYGMGRAAGNCPTEL
LVTHLKNTKYTLRPVLDIVENLMIPLREKEEWGYIIPYMITGTLDEHPRSAMALRSSADK
DKAVDFYDKLTTPEVNFGDK
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
attgtgaagactaatcagagcaaaattgtcgattgtaccatccgtgacgggggattggtg
aataactgggatttcagtattgaatttgttcagaaattatacgctggtttgaatgaagcc
ggtgttgattatatggaaatcggatataaaaactcaccgaagttgctgaaagggtccgag
ggtgccgggccgtggcgttttcttaatgatgatttcctgcgcaaggttattccgcaaaaa
ggccacaccaagctgtcggcactggtcgatatcggccgtgttgacgtgaatgatatcctg
ccccgcagtgagagtatgctggacctgatccgtgtagcctgctatagcaaagatgtggac
aaggcgcttgagctggtgcagaccttccacgatctggggtacgagactacgattaatatt
atggctctatccaatgtcatggagaatgaactgcttgaagcgtttgaacagatccgcgaa
agcgtcgttgatgttgtatatatcgttgattcctacggcagtctggatcacaatgacatc
cattacctggtagagaagttcagaacacatttgccggataaacgcctgggtgtacatacg
cataacaatctgcagctggccttctccaatacactgattgcagcggaaaaaggtgtcgaa
ctgctggacgcttcctgctacggcatgggccgtgctgccggcaattgtcctacagagctg
ctggttacccatttgaagaataccaagtataccctccgtcccgttctggatattgttgag
aacctgatgattccattgcgcgagaaggaagagtgggggtatatcatcccatacatgatt
acgggaacactggatgagcatccgcgctcggcgatggcgctgcgttcttcagccgataaa
gacaaggcggttgacttctatgacaaactgactacacctgaggttaatttcggggataaa
taa

DBGET integrated database retrieval system