KEGG   Paenibacillus sp. FSL R5-0912: R50912_13695Help
Entry
R50912_13695      CDS       T03334                                 

Definition
(GenBank) glucosylceramidase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
paeq  Paenibacillus sp. FSL R5-0912
Pathway
paeq00511  Other glycan degradation
paeq00600  Sphingolipid metabolism
paeq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paeq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    R50912_13695
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    R50912_13695
Enzymes [BR:paeq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     R50912_13695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Glyco_hydro_59
Motif
Other DBs
NCBI-ProteinID: AIQ40961
UniProt: A0A089JW22
Position
complement(3176178..3177524)
Genome map
AA seq 448 aa AA seqDB search
MSSPTVRVIQTAKETGDRLTELQPLSFRPDSEEKEMELINIYEDLEYQEIEGFGGALTEA
SAVTLAKLSPEKQQEIIDAYFHPEHGIGYTLCRSHIQSCDFSTGNYAYVDGVDPELATFN
ISRDQESILPLIKRAADAVGGSFRLFSSPWSPPAFMKTNGEMNNGGKLKPEYREAWANLF
VKYIQAYAEAGIDIWAVSVQNEAKAKQIWDSCIYTAEEEKDFVRDYLGPALEAAGLGHVK
IMIWDHNKERVYDRAKTAFTDQEAAKYIWGICFHWYSGDHFEALSAVHERFPDKKLFFSE
GCQEGGVHLGSWNTGERYGHDIIGNLNNWMSTWTDWNIVLDEQGGPNHVGNFCDAPIIGD
TLKDEVIYESSFYYIGHFSKYIRPGAVRVGSSRYTDKFETTAFRNTDGTYAVVVLNRTDS
RLPYTLHFRDQLAEGSIPAHAIQTLLFQ
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgagcagccctacagtccgcgtaatccagacagccaaagaaaccggtgaccggttaaca
gaattacagcctctgtccttccggcccgattccgaagagaaggaaatggaattgattaac
atttatgaggatttggaatatcaggaaattgaaggcttcggcggtgcgctgacggaagcc
tctgcagtcacgctggccaagcttagtccggagaagcagcaggaaataatcgatgcctac
ttccatccggagcacggaatcggctacaccctgtgcagatcacatatccagagctgtgac
ttctcaacaggcaactatgcttatgtagatggcgttgacccggagctggctactttcaat
atctccagagatcaggagtcgatacttccgttaatcaaacgcgcggctgacgctgtgggc
gggagcttccggctgttctcctccccatggagccctcctgccttcatgaagacgaacggc
gagatgaataacggcggcaagctgaagccggaataccgggaagcctgggctaatctgttc
gtgaaatacattcaggcttacgctgaagccggcatcgatatctgggcggtcagtgtgcag
aatgaagccaaagccaagcagatctgggattcctgcatttatactgctgaagaagagaag
gacttcgtacgcgattatctcggtcctgccctggaagcagccggcttaggccatgtcaaa
atcatgatctgggatcataataaagaacgggtctatgaccgggcgaagaccgcttttaca
gatcaggaagcagcaaagtatatctggggcatctgcttccactggtattccggtgatcat
ttcgaagccttgagcgctgtacatgagcgttttcctgacaaaaagctgttcttcagcgaa
ggctgccaggagggcggcgtacacctcggttcctggaacaccggcgaacgttacggccat
gatattatcggcaacctgaacaactggatgtccacctggacggactggaatatcgtcctt
gatgagcagggcggcccgaaccatgtgggtaacttctgcgatgcgccgattatcggtgac
accctgaaggatgaagtaatctatgagagctcgttctattacatcgggcatttcagcaag
tatatccgtccaggcgccgtccgtgtgggcagctccagatatactgacaaattcgaaact
acggcgttccgtaatacagacggcacctatgccgtggtcgtgctcaaccgcacggacagc
aggcttccatacaccctgcacttccgggatcagctggcggagggttcaattccggcccat
gcgattcaaaccctgctgttccaataa

DBGET integrated database retrieval system