KEGG   Paenibacillus sp. FSL R5-0912: R50912_14540Help
Entry
R50912_14540      CDS       T03334                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
paeq  Paenibacillus sp. FSL R5-0912
Pathway
paeq00450  Selenocompound metabolism
paeq00970  Aminoacyl-tRNA biosynthesis
paeq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paeq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    R50912_14540
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    R50912_14540
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:paeq01007]
    R50912_14540
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:paeq03016]
    R50912_14540
Enzymes [BR:paeq01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     R50912_14540
Amino acid related enzymes [BR:paeq01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   R50912_14540
Transfer RNA biogenesis [BR:paeq03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    R50912_14540
 Prokaryotic type
   Other AARSs
    R50912_14540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 DZR
Motif
Other DBs
NCBI-ProteinID: AIQ41101
UniProt: A0A089JWC2
Position
complement(3332843..3334519)
Genome map
AA seq 558 aa AA seqDB search
MTNIFIGGAWPYANGSLHLGRLASILPGDILARYHRAKGDAVLYVSGSDCHGTPVAVQAA
QEGVSPGEFASRYHQEFADCFRSLGFTYDLYTRTDQEHHHSVVQELFLKLLDNGHLYQKS
TLQCYCEQDQRYLPDRYVEGICPVCGQQARGDQCDYCSTILDPVDLLERTCKICGTPPVL
RSTLHYYLSLSSFQGALSEYVDSAQGWRDNAVRLTRRYLQEGLQDRAATRDLDWGVDVPV
DGFTDKKIYVWIEAVSGYLSASKQWAAGTGNRWEDFWLESTESKDAAYPPITAYYVHGKD
NVPFHSLIWPALLLGAGDLHLPDRIFSCEYMTLEGEKFSTSRNWAVWVPDILSRYDPDSI
RYFLTANGPEKRDADFSWREFIYSHNSELLGAFGNFVNRSLVFVNKFWNGEVPEGTMDAV
WASSINTLYSETGRLIEGGSFKEALEHVFTHIRQANKYFDQQQPWLQIRNDPAACGNTLY
TCVQITANLSNLLNPFIPFSCGKIRHFFALEQPLWQPVSVPAHQPVLELELLFERIDIAR
IGEETERLKSLQRRGGEG
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacatttttatcggaggggcttggccgtatgccaatggctccctgcacctgggc
aggcttgcgagtattctgccgggagatatcctggcccgctatcaccgtgccaaaggcgac
gctgtgctgtatgtctccggcagtgactgccacggcactccagttgctgtacaggcagcg
caggaaggtgtatcccctggtgaattcgccagcagatatcatcaggagttcgccgattgc
ttccgttcgcttggattcacctatgacttatacacccggaccgatcaggagcatcaccac
agtgtggtgcaggagctgttccttaagctgctggataacggccatctgtaccagaagtct
acgctccaatgctactgtgagcaggatcagcgctacttgccggaccgctatgtagaggga
atctgcccggtctgcggacagcaggccaggggtgaccaatgtgattactgttctacgata
ctcgacccggttgacctgctggagcgtacctgcaaaatctgcggaacccctccggtgctg
cgttccaccctgcattattatttgtcactgtccagcttccagggcgcactttcagaatac
gtagattctgcgcaaggctggagagacaatgctgtgcgtttaacccgcagatatctgcag
gaaggactgcaggaccgcgctgcaacgcgggatctggactggggggtggatgttccggtg
gacggcttcacggacaagaaaatctatgtgtggatcgaagcggtcagcggctatctgtcc
gccagcaagcagtgggctgccgggaccggcaaccgctgggaggatttctggctggaatcc
actgagagcaaagacgccgcgtaccctcccattacggcctattatgtgcatggcaaggat
aatgtgccttttcacagcctgatctggccggctctgctgctgggtgctggagacctgcat
ctgccggaccgcatcttctcctgtgaatacatgacgctggaaggggagaaattctccaca
agccgtaactgggccgtctgggtgccggatattctcagccgctacgacccggattccatc
cggtatttcctgacggcgaacggtcctgagaaacgggatgccgacttctcgtggagagaa
ttcatctacagccataacagcgagctgctgggcgccttcggtaatttcgttaaccgcagt
ctggtattcgtgaataagttctggaatggcgaggttcctgagggtacaatggatgccgtt
tgggccagcagcattaatactctgtacagcgagaccgggagacttattgaggggggcagc
ttcaaagaagcgctggagcatgtcttcacccatatccgccaggccaacaaatatttcgat
cagcagcagccgtggctgcagattaggaatgaccccgccgcctgcggcaacacgctgtat
acctgtgtgcagatcaccgctaatctgtctaatctgttgaacccgttcattccattctcc
tgcggcaagatcaggcatttctttgccttagaacagcctttatggcagccagtgtccgtt
ccggcacatcagccggtgctggagctggaattattgttcgaacggattgatatcgcgcgg
attggggaggagaccgagcgcctcaagagcttgcaacgccgtggcggcgagggctag

DBGET integrated database retrieval system