KEGG   Paenibacillus sp. FSL R5-0912: R50912_17210Help
Entry
R50912_17210      CDS       T03334                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
paeq  Paenibacillus sp. FSL R5-0912
Pathway
paeq00620  Pyruvate metabolism
paeq00630  Glyoxylate and dicarboxylate metabolism
paeq01100  Metabolic pathways
paeq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:paeq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    R50912_17210
   00630 Glyoxylate and dicarboxylate metabolism
    R50912_17210
Enzymes [BR:paeq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     R50912_17210
    1.2.1.22  lactaldehyde dehydrogenase
     R50912_17210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487 FlaG PSK_trans_fac
Motif
Other DBs
NCBI-ProteinID: AIQ41584
UniProt: A0A089L9S5
Position
3900759..3902189
Genome map
AA seq 476 aa AA seqDB search
MYIDGQFTESEGKEWIEVTNPATDEVISQVPKATRNDVIRAINAAEEAQLAWEESPAVER
GRYLHAIADGIRAEADSIARLISEEVGKTLELSAVEVNFTADYLDYMAEWARRYEGEIVQ
SDRDNENIFVFKRAIGVTTGILPWNFPFFLIARKMAPALITGNTIVVKPSAESPNNAVAF
SRIVDKAGLPKGVFNLVTGRGGEVGHELASNPKVGMVSLTGSVHAGQKVMEAAAENIIKV
SLELGGKAPAIVMKDADLDLAIKAIVDSRVINTGQVCNCAERVYVHEGIKDEFTSRLVEA
MKAVKYGDPLKDKDIHMGPLINKAAQESVQQKVDCAVQEGATIALGGKKVEGAGSFFEPT
VITNATNDMEIVQDEIFGPVIPVISFSTLDEAIALANDSEFGLTSSLYTQNLNVAMKVIK
RLKYGETYINRENFEAMQGFHAGWRKSGIGGADGKHGLNEYLQTHVVYLQYDKSVN
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtatatcgatggccaatttacggaatccgaaggcaaagaatggatcgaagtaaccaac
ccggcaacagatgaagtaatctcacaggttcccaaggctacaaggaatgatgtcatacgt
gccattaatgcagcggaagaagcccaattagcctgggaggaatctccggccgtcgagaga
ggtagatatttgcatgccattgcagacgggatacgcgcggaggcggacagcatcgccagg
ctgatctcggaagaagtaggcaagacattggaattatctgcggtagaggttaactttaca
gcggattatttggattatatggcggaatgggcacggcgttatgaaggggagatcgttcag
agcgaccgtgataatgagaatatttttgtgtttaaacgggcaattggtgtaacgacaggc
atcctgccctggaatttcccgttcttcctgatcgcaagaaagatggctccggcgctgatt
accggcaatacgattgtcgtcaagccaagtgcggaatccccgaacaatgccgtggccttc
agccgtattgttgataaagccggcctgcccaaaggggtattcaacctggtaacaggcaga
ggcggagaagtaggccatgaactggccagtaacccgaaggtcggaatggtcagtcttaca
ggcagtgtacacgccggacaaaaggtgatggaggcggccgccgagaatatcatcaaggtc
agtctggagctgggcggcaaggcaccggcgattgtcatgaaggatgccgatctggacctg
gcgatcaaagcgatcgtagattcccgggtgattaatacaggccaagtctgtaactgtgca
gagcgcgtctatgtacatgagggcattaaggatgaattcacctcccgcctggttgaagct
atgaaggcagtgaaatacggagacccgctcaaggataaggatattcatatggggccgctg
attaataaggccgcacaggaatcggttcaacagaaggtagactgtgcagtacaagagggg
gctacaattgctcttggcggtaaaaaggtagaaggtgcaggcagtttcttcgagccgacg
gtcatcacgaatgccaccaacgacatggagattgtgcaggatgaaatcttcggaccggtt
atcccggtcatttcgttctccaccctggatgaagcgatcgcgcttgccaacgacagtgaa
ttcggcttaacctcgtccttatatacccagaatttgaatgtcgctatgaaagtaatcaaa
cgtctgaaatacggagagacctacattaaccgcgagaattttgaagcgatgcagggcttc
cacgcaggctggagaaagtccgggatcggcggtgccgacggcaaacatggactgaacgaa
tacctgcagacgcacgtagtctatctacagtatgacaagtcagttaactaa

DBGET integrated database retrieval system