KEGG   Paenibacillus sp. FSL R5-0912: R50912_20735Help
Entry
R50912_20735      CDS       T03334                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
paeq  Paenibacillus sp. FSL R5-0912
Pathway
paeq00071  Fatty acid degradation
paeq00280  Valine, leucine and isoleucine degradation
paeq00310  Lysine degradation
paeq00362  Benzoate degradation
paeq00380  Tryptophan metabolism
paeq00620  Pyruvate metabolism
paeq00630  Glyoxylate and dicarboxylate metabolism
paeq00640  Propanoate metabolism
paeq00650  Butanoate metabolism
paeq00900  Terpenoid backbone biosynthesis
paeq01100  Metabolic pathways
paeq01110  Biosynthesis of secondary metabolites
paeq01120  Microbial metabolism in diverse environments
paeq01130  Biosynthesis of antibiotics
paeq01200  Carbon metabolism
paeq01212  Fatty acid metabolism
paeq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:paeq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    R50912_20735
   00630 Glyoxylate and dicarboxylate metabolism
    R50912_20735
   00640 Propanoate metabolism
    R50912_20735
   00650 Butanoate metabolism
    R50912_20735
  09103 Lipid metabolism
   00071 Fatty acid degradation
    R50912_20735
   00072 Synthesis and degradation of ketone bodies
    R50912_20735
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    R50912_20735
   00310 Lysine degradation
    R50912_20735
   00380 Tryptophan metabolism
    R50912_20735
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    R50912_20735
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    R50912_20735
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    R50912_20735
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:paeq04147]
    R50912_20735
Enzymes [BR:paeq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     R50912_20735
Exosome [BR:paeq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   R50912_20735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIQ42199
UniProt: A0A089LBJ6
Position
complement(4699293..4700444)
Genome map
AA seq 383 aa AA seqDB search
MNEAVLVMARRTPVGKIGGQLSLLEPEQLLAPLIRLLVTEAQLPPEWIDDVIIGNVVGPG
GNIARKSVLEAGLPVTVPGVTVDRQCGSGLEAIIMAARLIQSGAGEIFLAGGVESASRAP
WKMFRPHTLSGTPTLYTRAPFTPVAYGDPDMGLAAEHVASKYGITREAQDLYALESHQKA
VRAKRTGRYAPELVPLQANGFRITEDECPRPDTSLGKLGSLPPVFAANGTVTAGNACPVN
DGAALVLMMSREKCKRLNLKPILRFVDSQAAGVDPRYPGIGPVPAVRKLLGRQRLAVGDL
DIVEFNEAFAAQVLASLQELQLPPGKVNPGGGALALGHPYGASGAILMTRLYSEMLQTPY
RRGLATLGIGGGMGLAVLVEAVL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaggccgttcttgtcatggccaggcgtacacctgtcgggaaaatcggtgggcag
ttaagcctgcttgaaccggagcagctgcttgccccactgatccgcctcctcgttaccgaa
gcacagctgccgccggaatggattgatgatgtcatcataggcaatgtagtgggtccgggc
gggaatattgcccgcaagtctgtgcttgaagcagggctgccggtcacagttccgggagtc
acggtcgaccgccaatgcggctcagggcttgaagccatcatcatggcagcacgcctcatt
cagagcggtgccggagagatattcctggcaggcggagtcgaaagtgcaagccgggcaccc
tggaaaatgttcagaccgcacacgctgagcggcacgccaaccctgtacacacgcgcgccg
ttcacgcccgttgcttacggagatcctgatatggggcttgctgcagagcatgtagcgtcc
aaatacgggattacccgggaggcgcaggatctgtatgcgcttgagagccaccaaaaggca
gtccgcgccaagcgtacaggcagatatgcaccggagcttgtaccgcttcaagctaacgga
ttccggattacagaggatgaatgtccaaggccggatacaagcctggggaagctgggcagc
ctgccgccggtttttgcggcgaatggcaccgtgactgccgggaatgcctgccccgttaat
gatggcgccgctctggtgctcatgatgtcgcgtgaaaaatgcaaacggcttaacctaaag
cccatcctccgttttgtagactcgcaggctgccggggtggacccccggtatccggggatc
ggaccggtcccggcggtccggaaactgctgggccgccagcggctggcagtcggcgatctg
gatatcgttgaatttaatgaagcttttgccgcccaggtactggcctccttgcaggagctt
cagcttcctccgggtaaggtcaatcccggcggcggtgcattggctctgggccatccttac
ggagcctccggtgcgatcctgatgacgcgtctatattcggagatgctgcagaccccttac
agacgggggctggctacgcttggcattggcggcggaatggggctggctgttctggtagag
gcggtcctatga

DBGET integrated database retrieval system