KEGG   Paenibacillus sp. FSL R5-0912: R50912_23370Help
Entry
R50912_23370      CDS       T03334                                 

Definition
(GenBank) aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
paeq  Paenibacillus sp. FSL R5-0912
Pathway
paeq00051  Fructose and mannose metabolism
paeq01100  Metabolic pathways
paeq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:paeq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    R50912_23370
Enzymes [BR:paeq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     R50912_23370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AIQ42664
UniProt: A0A089LCX5
Position
complement(5265914..5266564)
Genome map
AA seq 216 aa AA seqDB search
MNTKEEELRRLICDIGRNLFNKDFIAANDGNISARLSATEVITSPTGVSKGYLQPHMLVK
VNLQGDILEAAEGYRPSTEVKMHLKIYNELPQMGGVVHAHPPYATAFAIKGEALDKMMMP
ESVIAMGDIPLAVYGTPSTEEIPDSLIPFLGKKTAVLLESHGALTWGKDVMSAYMNMERL
EYTAKLTFLTRMIGGERELPQHRIEELVALRSFYGM
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgaatacgaaggaagaggaattgcgccggcttatctgtgatatcggccgcaatctgttt
aataaggactttattgccgccaatgacggcaacatctcggcacggctgtcggctacagag
gtaatcacctcaccaacaggagtcagcaaaggctatctgcagccgcatatgctggtcaaa
gtgaatctgcagggagatatccttgaagctgcggaaggctaccggccatccacagaagtg
aagatgcatctgaagatttacaatgagctgccgcagatgggcggtgtagttcatgcacat
ccgccatatgcgaccgcttttgccatcaagggtgaagcgctcgacaagatgatgatgcct
gagtctgtgattgccatgggggacattccactggcggtatacgggacgccttcaactgaa
gagattccggattcgctaatccccttccttggcaagaaaaccgctgtactgctggaaagt
catggtgccctgacctggggcaaggacgtaatgagcgcatacatgaatatggagcggctt
gagtatacagcgaagctgaccttcctgacccggatgattggcggggaacgtgagctgcca
cagcaccggatcgaggaactggtagctttgagatcattctacggcatgtaa

DBGET integrated database retrieval system