KEGG   Pseudomonas aeruginosa PA1R: PA1R_gp1293Help
Entry
PA1R_gp1293       CDS       T02929                                 

Definition
(GenBank) Malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
paer  Pseudomonas aeruginosa PA1R
Pathway
paer00020  Citrate cycle (TCA cycle)
paer00620  Pyruvate metabolism
paer01100  Metabolic pathways
paer01110  Biosynthesis of secondary metabolites
paer01120  Microbial metabolism in diverse environments
paer01130  Biosynthesis of antibiotics
paer01200  Carbon metabolism
Module
paer_M00009  Citrate cycle (TCA cycle, Krebs cycle)
paer_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:paer00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PA1R_gp1293
   00620 Pyruvate metabolism
    PA1R_gp1293
Enzymes [BR:paer01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     PA1R_gp1293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO
Motif
Other DBs
NCBI-ProteinID: AHA23046
Position
1447828..1449375
Genome map
AA seq 515 aa AA seqDB search
MCVSVLGCSKNSVESEKPVDVLLIGGGIMSATLGTYLNELEPGWTIEMVERLDKVAEESS
NGWNNAGTGHSAFCELNYTSEAADGSMDISKAVAINENFEISKQFWAYQVDRKVLNDPKS
FINNVPHMSFVWGDDNVAFLKKRHAALQHSSLFRGMEYSEDPEQIKQWVPLVMEGREPGQ
KIAATRMSIGTDVNFGEITRQLVGSLSAKDTFKLRLQHEVRDLKRNDDNTWTVTMADLAN
GDKETSVKARFVFIGAGGGALKLLQMSGIPEAEGYAGFPVGGSFLATTNPDVVKRHLAKV
YGKASVGSPPMSVPHLDTRMIDGKPVLLFGPFATFSTKFLKNGSLWDLPGSVTSGNIGPM
FNAGIDNFDLSQYLIGQLMLSQDDRMASLREYFPEARDEDWKLVQAGQRVQIIKKDAEKG
GVLQFGTEVVTAADGSVAALLGASPGASTAAPIMLSVLEKAFKDKVATPEWQARLKEIVP
SYGRKLNNDIELTNSTRAWSSERLQLIHVPVQPEA
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
ttgtgcgtcagcgtgctgggttgctccaaaaacagcgtcgaatcggaaaaaccggtcgac
gtgctcctgatcggtggcggcatcatgagcgccaccctgggtacctatctgaacgaactg
gaaccaggctggaccatcgagatggtcgagcgcctggacaaggtcgccgaagaaagctcc
aacggctggaacaacgcgggcaccggtcactcggcgttctgcgaactgaactacaccagc
gaggccgcggacggctcgatggatatcagcaaggcggtggcgatcaacgagaacttcgag
atctccaagcagttctgggcctaccaggtcgaccgcaaggtgctgaacgatccgaagtcg
ttcatcaacaacgtcccgcacatgagcttcgtctggggcgacgacaacgtcgccttcctc
aagaagcgccacgccgccctgcagcacagctcgctgttccgcggcatggagtactcggaa
gaccccgagcagatcaagcagtgggtgccgctggtgatggaaggccgcgagccggggcag
aagatcgccgccacgcgcatgtcgatcggcaccgacgtcaacttcggcgagatcactcgc
caactggtgggctcgctgtcggccaaggacaccttcaagctgcgcctgcaacatgaggtc
cgcgacctcaagcgcaacgacgacaacacctggaccgtgaccatggccgacctggccaat
ggcgacaaggaaaccagcgtcaaggccaggttcgtcttcatcggcgccggcggcggcgcg
ctgaagctgctgcagatgtccggcatccccgaggccgaaggctacgccggcttcccggtg
ggcggttcgttcctcgccaccaccaacccggacgtggtcaagcgccacctggccaaggtc
tacggcaaggcttcggtgggttcgccgccgatgtcggtgccgcacctcgacacccgcatg
atcgacggcaagccggttctgctgttcggtccgttcgccaccttctccaccaagttcctg
aagaacggctcgctgtgggacctgccgggctcggtgaccagcggcaacatcggcccgatg
ttcaacgccggcatcgacaacttcgatctcagccagtacctgatcggccagttgatgctc
agccaggacgaccgcatggcctcgctgcgcgagtacttcccggaagcccgcgacgaggac
tggaagctggtgcaggccggccagcgcgtgcagatcatcaagaaggacgccgagaaaggc
ggcgtactgcaattcggcaccgaagtggtgaccgcagcggacggctccgtcgccgccctg
ctcggcgcctcgccgggcgcctcgaccgccgcgccgatcatgctgtcggtgctggagaag
gccttcaaggacaaggtcgctactcccgagtggcaggcacgcctgaaggaaatcgtgccg
tcttacgggcgcaagctgaacaacgacatcgagctgaccaacagcacccgtgcctggagc
agcgagcgcctgcaactgatccacgtgccggtacagccggaggcctga

DBGET integrated database retrieval system