KEGG   Pseudomonas aeruginosa PA1R: PA1R_gp2447Help
Entry
PA1R_gp2447       CDS       T02929                                 

Definition
(GenBank) Ribosomal large subunit pseudouridine synthase D
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
paer  Pseudomonas aeruginosa PA1R
Brite
KEGG Orthology (KO) [BR:paer00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:paer03009]
    PA1R_gp2447
Enzymes [BR:paer01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     PA1R_gp2447
Ribosome biogenesis [BR:paer03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    PA1R_gp2447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 TruB_N
Motif
Other DBs
NCBI-ProteinID: AHA24186
Position
complement(2737338..2738300)
Genome map
AA seq 320 aa AA seqDB search
MSDMIQRAAEVPFELGGQRLDQIAAQLFPEHSRSRLAGWIKDGRLTVDGAVLRPRDIVHS
GAQLVLEAEQEAQGEWLAQDIELEIVYEDEHILVIDKPAGLVVHPAAGHQDGTLLNALLY
HVPDIANVPRAGIVHRLDKDTTGLMVVAKTLEAHTKLVAQLQARSVSRIYEAIVIGVITS
GGTIDAPIGRHGVQRQKMAVVDAGKVAVSHYRVLERFRAHTHTRVKLETGRTHQIRVHMS
HIGYPLVGDPVYGGRFRIPPVASQTLVQTLREFPRQALHARFLELDHPATGVRMKWESPL
PEDFLWLLSLLRQDREAFVG
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatatgattcaacgcgcggccgaggtgccgttcgagctgggtggccagcgtctc
gaccagatcgccgcccagctttttcccgaacactcccgctcccgtctggccggctggatc
aaggacggtcgcctgaccgtcgacggcgccgtgctgcgcccgcgcgacatcgtccacagc
ggcgcgcaactggtcctggaggccgagcaggaagcccagggcgagtggctcgcacaggac
atcgagctggaaatcgtctacgaggacgagcacatcctggtgatcgacaagcccgccggc
ctggtggtccatccggctgccggccatcaggacggcaccctgctgaatgccttgctctac
catgtcccggacatcgccaatgtgccgcgcgccgggatcgtccaccgcctggacaaggac
acgaccggcctgatggtagtggccaagacgctggaggcccacaccaagctggtggcgcaa
ctgcaggcacggtcggtcagccgcatctacgaggcgatcgtgatcggcgtgatcacctcc
ggcggcaccatcgatgcgccgatcggacggcatggcgtgcagcggcagaagatggcggtg
gtcgacgccggcaaggtggcggtcagccattaccgcgtgctggaacgcttccgtgcgcac
acccatacccgggtcaagctggagaccgggcgtacccaccagatccgcgtgcacatgagc
catatcggctatcccctggtcggcgatccggtctacggtgggcgcttcaggattcccccg
gtggccagccagaccctggtccagactcttcgcgagttcccccggcaggcgctgcacgcg
cgcttcctcgaactggatcacccggccaccggcgtgcgcatgaagtgggagtcgccgctg
ccggaagacttcctctggctgctcagcctgttgcgccaggatcgcgaggcgttcgtcgga
tga

DBGET integrated database retrieval system