KEGG   Pseudomonas aeruginosa PA1R: PA1R_gp2702Help
Entry
PA1R_gp2702       CDS       T02929                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
paer  Pseudomonas aeruginosa PA1R
Pathway
paer00071  Fatty acid degradation
paer00280  Valine, leucine and isoleucine degradation
paer00310  Lysine degradation
paer00362  Benzoate degradation
paer00380  Tryptophan metabolism
paer00620  Pyruvate metabolism
paer00630  Glyoxylate and dicarboxylate metabolism
paer00640  Propanoate metabolism
paer00650  Butanoate metabolism
paer00900  Terpenoid backbone biosynthesis
paer01100  Metabolic pathways
paer01110  Biosynthesis of secondary metabolites
paer01120  Microbial metabolism in diverse environments
paer01130  Biosynthesis of antibiotics
paer01200  Carbon metabolism
paer01212  Fatty acid metabolism
paer02020  Two-component system
Brite
KEGG Orthology (KO) [BR:paer00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PA1R_gp2702
   00630 Glyoxylate and dicarboxylate metabolism
    PA1R_gp2702
   00640 Propanoate metabolism
    PA1R_gp2702
   00650 Butanoate metabolism
    PA1R_gp2702
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PA1R_gp2702
   00072 Synthesis and degradation of ketone bodies
    PA1R_gp2702
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PA1R_gp2702
   00310 Lysine degradation
    PA1R_gp2702
   00380 Tryptophan metabolism
    PA1R_gp2702
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PA1R_gp2702
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PA1R_gp2702
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PA1R_gp2702
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:paer04147]
    PA1R_gp2702
Enzymes [BR:paer01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PA1R_gp2702
Exosome [BR:paer04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PA1R_gp2702
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AHA24431
Position
complement(3017732..3019009)
Genome map
AA seq 425 aa AA seqDB search
MTQLRRVAIVGGNRIPFARSNTVYATASNQEMLTSALEGLVERYNLHGERLGEVVAGAVL
KHSRDFNLTRECVLGSRLAPETPAYDIQQACGTGLEAAILVANKIALGQIDSGIAGGVDT
TSDAPIGVNEGLRKILLEANRGKSNLDKLKSLLKIRPRHVVPAIPRNGEPRTGLSMGESC
ELMAQTWQIPRDEQDRLAFESHHKLAAAYEEGWQNDLMTPFRGLTRDQNLRPDIDLEKIG
TLKPVFERGSRGTLTAANSTPLTDGASVVLLASEEWAKARGLPILAYFKDGEAAAVNFVD
RQEGLLMAPVYAVPRLLARNGLSLQDFDYYEIHEAFAAQVLCTLKAWEDPEYCKTRLGLD
QPLGSIDRSKLNVKGSSLAAGHPFAATGGRIVANLAKLLSLAEQGRGLISICAAGGQGVT
AIIER
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgacccagctgcgccgggtcgccattgtcggcggcaaccgtattcccttcgcccgctcg
aacaccgtgtacgccacggcgagcaaccaggagatgctcacttccgccctggaaggcctg
gtggagcgctacaacctgcacggagagcgccttggcgaggtggtggccggcgccgtgctg
aagcattcgcgcgacttcaacctgacccgcgaatgcgtgctcggttcgcgcctggccccg
gaaaccccggcctacgatatccagcaggcctgcggtaccggcctggaggcggcgatcctg
gtggccaacaagatcgccctcgggcagatcgacagcggcatcgccggcggcgtcgatacc
acttccgacgcgccgatcggggtcaacgagggcctgcgcaagattctcctcgaggccaac
cgcggcaagagcaacctggacaagctcaagagcctgctgaagatccgcccgcgccacgtg
gtcccggccatcccgcgcaacggcgagccgcgcaccgggctgtcgatgggggagtcctgc
gaactgatggcgcagacctggcagattccccgcgacgagcaggacaggctggccttcgag
agccaccacaagctggccgcggcctatgaggagggctggcagaacgacctgatgacgccg
ttccgcggcctgacccgcgaccagaacctgcgcccggatatcgacctggagaagatcggc
accctcaagccggtgttcgagcgcggttcgcgcggcaccctcacggcggccaactcgacg
ccgctgaccgacggcgcctcggtggtactgctggccagcgaggagtgggcgaaggcgcgc
ggcctgccgatcctggcctatttcaaggacggcgaggcggcggcggtgaacttcgtcgat
cgccaggagggcctgctgatggcgccggtctacgcggtgccgcggctgctggcacgcaac
ggcctgagtctgcaggacttcgactactacgagatccacgaggccttcgccgcccaggtg
ctctgcaccctgaaggcctgggaagaccccgagtactgcaagacccgcctcggcctcgac
cagccgctgggctccatcgaccgcagcaagctcaacgtcaagggcagctcactggccgcc
ggccacccgttcgccgccacgggaggacggatcgtcgccaacctggccaagctgctctcg
ctggcggagcagggacgcgggctgatttccatctgcgccgccggtgggcagggtgtgacc
gcgatcatcgagcggtaa

DBGET integrated database retrieval system