KEGG   Pseudomonas aeruginosa PA1R: PA1R_gp3370Help
Entry
PA1R_gp3370       CDS       T02929                                 

Definition
(GenBank) Pyruvate carboxyl transferase subunit A
  KO
K01959  pyruvate carboxylase subunit A [EC:6.4.1.1]
Organism
paer  Pseudomonas aeruginosa PA1R
Pathway
paer00020  Citrate cycle (TCA cycle)
paer00620  Pyruvate metabolism
paer01100  Metabolic pathways
paer01120  Microbial metabolism in diverse environments
paer01200  Carbon metabolism
paer01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:paer00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PA1R_gp3370
   00620 Pyruvate metabolism
    PA1R_gp3370
Enzymes [BR:paer01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     PA1R_gp3370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp RimK ATP-grasp_3 ATP-grasp_4 ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: AHA25089
Position
complement(3766050..3767465)
Genome map
AA seq 471 aa AA seqDB search
MIKKILIANRGEIAVRIVRACAEMGIRSVAVYSEADRHALHVKRADEAHSIGADPLAGYL
NPRALVNLAVESGCDALHPGYGFLSENAELAEICAERGIKFIGPSAQVIRRMGDKTEARR
SMIAAGVPCTPGTEGNVADLAEALREAERIGYPVMLKATSGGGGRGIRRCNSREELEQAF
PRVISEATKAFGSAEVFLEKCIVNPKHIEAQILADSFGNTVHLFERDCSIQRRNQKLIEI
APSPQLTPEQRAYIGDLAVRAAKAVGYENAGTVEFLLADGEVYFMEMNTRVQVEHTITEE
ITGIDVVREQIRIASGLELSVKQDDIVHRGYALQFRINAEDPKNNFLPSFGKITRYYAPG
GPGVRTDTAIYTGYTIPPYYDSMCLKLIVWALTWEEALDRGLRALDDMRVQGVKTTAPYY
QEILRNPEFRSGQFNTSFVESHPELTQYSIKRNPSHLAIAIATAIAAHAGL
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgatcaagaagatcctgatcgccaaccgcggcgagattgccgtccgcatcgtgcgcgcc
tgcgccgagatgggcatccgctcggtggccgtctactccgaggccgatcgccacgcgctg
cacgtcaagcgcgccgacgaagcccacagcatcggcgcggacccgctggccggctacctc
aacccgcgcgccctggtgaacctggcggtggaaagtggctgcgacgccctgcaccccggc
tatggcttcctctcggaaaatgccgagctggcggaaatctgcgccgagcgcggtatcaag
ttcatcggcccgtcggcgcaagtgatccgccgcatgggcgacaagaccgaagcccgccgc
agcatgatcgccgccggcgtgccctgcacccccggcaccgaaggcaacgtcgccgatctc
gctgaggccctgcgcgaagccgagcggatcggctacccggtgatgctcaaggccacctcc
ggcggcggcggtcgcggcatccgtcgctgcaacagccgcgaggagctggaacaggcgttc
ccgcgggtgatctccgaggcgaccaaggccttcggcagcgccgaggtattcctcgagaag
tgcatcgtcaatcccaagcacatcgaggcgcagatcctcgccgattccttcggcaacacc
gtgcacctgttcgagcgcgactgctcgatccagcgccgcaaccagaagctcatcgagatc
gccccgagcccgcagctcacccccgagcagcgcgcctatatcggcgacctggcggtgcgc
gcggccaaggcggtgggctacgagaacgccggcaccgtggagttcttgctcgccgacggc
gaggtgtacttcatggagatgaacacccgggtccaggtggagcacaccatcaccgaggag
atcaccggcatcgacgtggtccgcgagcagatccgcatcgcttccgggctggagctgtcg
gtcaagcaggacgacatcgtccatcgcggctacgccctgcagttccgcatcaacgccgag
gacccgaagaacaacttcctgccctcgttcggcaagatcacccgctactacgcccccggc
ggccccggcgtgcgtaccgacacggcgatctacaccggctacaccatcccgccgtactac
gactcgatgtgcctgaagctgatcgtctgggcgctgacctgggaagaggccctcgatcgc
ggcctgcgcgccctcgatgacatgcgcgtgcaaggggtcaagaccaccgcgccgtactac
caggaaatcctccgcaacccggaattccgcagcggccagttcaacaccagcttcgtcgaa
agccacccggaactgacccagtactcgatcaagcgcaacccgtcgcacctggccatcgcc
atcgccaccgccatcgcggcccacgccggcctgtaa

DBGET integrated database retrieval system