KEGG   Pseudomonas aeruginosa PA1R: PA1R_gp3595
Entry
PA1R_gp3595       CDS       T02929                                 

Definition
(GenBank) Uncharacterized protein ImpI/VasC
  KO
K11913  type VI secretion system protein
Organism
paer  Pseudomonas aeruginosa PA1R
Pathway
paer02025  Biofilm formation - Pseudomonas aeruginosa
paer03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:paer00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PA1R_gp3595
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PA1R_gp3595
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:paer02044]
    PA1R_gp3595
Secretion system [BR:paer02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   PA1R_gp3595
SSDB
Motif
Pfam: FHA Yop-YscD_cpl
Other DBs
NCBI-ProteinID: AHA25314
Position
complement(4027008..4028501)
AA seq 497 aa
MPLRLTITSYHKLTPGQCSEKVLDQGQLTIGRGPDNDWVLPDPERLVSSRHCTILNRDGV
YYLTDTSTNGVLLVNAGHRLRRGNSEPLQDGETVRLGEYDILVQLGHDIALPGSGNPQTD
PFTSFDALMSRQAAGSAPAFAEPAPTPHPAVTAHFQGGSPLDTKPDLFDFLTPPPPGAAP
RPDHVPAEQHDFRPPEPVIPPPPATTPAPPPAGGAPLIPADWDPFAELLGNTPAPSATPV
AQPLPTAEPTPLAMPFADPGITQQPQPQPQPQPQPQPQPQPQPQPASVAAPTPPASAAAS
AGGDLLQAFLRGAGMTQLKVDPAGAEAQMEAIGRSYRGLVEGLVDVLRARASLKGEFRMA
QTMIQPVQNNPLKFAPNVDEAMLLLLRRDNQAFMAPDRAVADSFEDLKAHQLAVMAGVQA
AIRHLLARFEPAALEARFGKPAGLSGLLPGARQAQNWDSFTELYAKILREAEDDFQELFG
REFSRAYEEHSARLRRS
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgccgctgcgattgaccatcaccagctaccacaagctgacccccggtcagtgttcggaa
aaggtactggaccagggacagctgaccatcggtcggggcccggacaacgactgggtcctg
ccggacccggagcgcctggtctccagccgccactgcaccatcctcaaccgcgacggggtg
tactacctcaccgacaccagcaccaacggcgtgctgctggtcaatgccgggcaccgcctg
cgccgcggcaacagcgagccgctgcaggacggcgagaccgtccgcctcggcgaatacgac
atcctcgtccagctcggccatgacatcgccctgcccggcagcggcaatccgcagaccgat
ccgttcaccagcttcgacgccctgatgagccggcaggccgccggatcggcgcctgccttc
gccgaaccggcgcccaccccgcaccccgcggtgacggcgcatttccagggcggctcgccg
ctggacaccaagcccgacctgttcgacttcctcaccccgccgccgcccggcgcggcgccg
cgtccggaccatgtaccggccgaacagcacgacttccgcccgccggaaccggtgatcccg
ccgccccccgcgaccaccccggcgccaccgcccgctggcggcgcaccgctgattccggcc
gactgggacccgttcgccgaactgctcggcaacacgcccgcgccaagcgccacgcccgtc
gcccagccgctgccgacggccgaaccgacgccgctggcgatgcccttcgccgacccaggg
atcacccaacagccacagccacagccacagccacagccacagccacagccacagccacag
ccacagccacagccagcgagcgtggcggcgccgacgccgccggcaagcgccgccgcgtcg
gccggcggcgacctgctgcaagcgttcctgcgcggcgccggcatgacccagttgaaggtc
gacccggccggcgccgaagcgcagatggaagccatcggccgcagctatcgcggcctggtg
gaaggactggtggacgtgctgcgcgcgcgggccagcctgaagggcgagttccgcatggcg
cagaccatgatccagccggtgcagaacaacccgctgaagttcgcgccgaacgtcgacgag
gccatgctgctcctgctgcgccgcgacaaccaggcgttcatggcgccggatcgcgcggtg
gccgacagcttcgaagacctcaaggcgcaccagctggcggtgatggccggcgtgcaggcc
gccatccgccacctgctggcgcgcttcgaaccggccgcgctggaagcccgcttcggcaag
ccggccgggctttccggcctgctgccgggggcccgccaggcacagaactgggacagtttc
accgagctgtacgcgaagatcctgcgcgaggcggaggacgacttccaggagcttttcggc
cgcgaattcagccgcgcctacgaggaacacagcgctcgactacggcgttcctga

DBGET integrated database retrieval system