KEGG   Pseudomonas aeruginosa PA1R: PA1R_gp4102Help
Entry
PA1R_gp4102       CDS       T02929                                 

Definition
(GenBank) ApaG protein
  KO
K06195  ApaG protein
Organism
paer  Pseudomonas aeruginosa PA1R
Brite
KEGG Orthology (KO) [BR:paer00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    PA1R_gp4102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AHA25819
Position
complement(4567470..4567850)
Genome map
AA seq 126 aa AA seqDB search
MSDTQHQVNVRVDTRYLPEQSAPEQNRFAFAYTVTIENQGEVPAQLLSRHWIITDGDGRT
QEVRGAGVVGEQPLIAPGAQHTYTSGTVLATRVGSMRGSYQMLGSDGIAFDAAIPVFRLA
VPGALH
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatacccagcaccaggtcaacgtcagggtcgacacccgctaccttccggaacag
tccgccccagagcagaaccgtttcgccttcgcctacacggtgaccatcgagaaccagggc
gaggttccggcccaactgctgtcgcgccactggatcatcaccgacggcgacggccgtacc
caggaagttcgcggcgccggcgtggtcggcgagcaaccgctgatcgcccccggcgcgcaa
cacacctacaccagcggcacggtgctggcgacccgggtcggcagcatgcgcggcagctac
cagatgctcggcagcgacggaatcgccttcgacgccgcgatcccggtgtttcgcctggcc
gtaccgggagcgctgcactga

DBGET integrated database retrieval system