KEGG   Pseudomonas aeruginosa PA1R: PA1R_gp4772Help
Entry
PA1R_gp4772       CDS       T02929                                 

Definition
(GenBank) Ribosomal RNA large subunit methyltransferase A
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
paer  Pseudomonas aeruginosa PA1R
Brite
KEGG Orthology (KO) [BR:paer00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:paer03009]
    PA1R_gp4772
Enzymes [BR:paer01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     PA1R_gp4772
Ribosome biogenesis [BR:paer03009]
 Prokaryotic Type
  rRNA modification factors
   23S rRNA modification factors
    PA1R_gp4772
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_23 Methyltransf_12 Methyltransf_32 MTS Methyltransf_18 MetW
Motif
Other DBs
NCBI-ProteinID: AHA26477
Position
complement(5320032..5320835)
Genome map
AA seq 267 aa AA seqDB search
MLICPLCSAALGEVDNGVACPAGHRFDRARQGYLNLLPVQHKKSLDPGDNAAMVEARRQF
LGAGHYAPLARRLAELAAERAPRRWLDIGCGEGYYSARLGEALAGAEGYALDISREAVKR
ACRRAPQLSWLVASMARLPLADASCELIASVFSPIDWNEAVRVLAPGGGVLRLGPASAHL
LELRQRLYDDVRDYADDKHLAGLPAQLRLRHTETLEFRLALDSYDARENLLAMTPHGWRV
NPERRARILAEPFEVSVAVRYDWLQRD
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgctgatctgcccgctctgctccgccgccctgggcgaggtcgacaacggcgtcgcctgc
cccgccgggcaccgcttcgaccgcgcccgccagggctacctgaacctgctgccggtgcag
cacaagaaaagcctcgatccgggcgacaacgccgccatggtcgaggcccgtcgccagttc
ctcggcgccggccactacgcgccgcttgcccggcgcctggccgaactggccgccgaacgc
gcgccgcgacgctggctggatatcggttgcggcgagggctactacagcgcccggctcggc
gaagccctggcaggcgccgaaggctatgccctggacatctcccgcgaggcagtgaaacgc
gcctgccgccgcgcgccgcagttgtcctggctggtggcgagcatggcccggctgccgctg
gccgacgccagttgcgagctgatcgccagcgtgttcagccccatcgactggaacgaagcc
gtgcgcgtcctcgcccccggcggcggcgtactgcgcctgggcccggccagcgcgcacctg
ctggaactgcgccagcggctctatgacgacgtgcgcgactacgccgacgacaagcacctc
gccggcctgcccgcgcaactgcgcctgcgccacaccgagaccctcgagttccgcctggcg
ctggacagctacgacgcgcgggaaaacctcctggccatgaccccgcacggctggcgggtc
aaccccgagcgccgcgcgcgaatcctggccgaacccttcgaagtcagcgtggcggtgcgc
tacgattggctgcaacgcgactga

DBGET integrated database retrieval system