KEGG   Pseudomonas aeruginosa PA1R: PA1R_gp4894Help
Entry
PA1R_gp4894       CDS       T02929                                 

Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
paer  Pseudomonas aeruginosa PA1R
Pathway
paer00480  Glutathione metabolism
paer00590  Arachidonic acid metabolism
paer01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paer00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    PA1R_gp4894
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PA1R_gp4894
Enzymes [BR:paer01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PA1R_gp4894
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AHA26599
Position
5457568..5458122
Genome map
AA seq 184 aa AA seqDB search
MKPRVLLSVLALAGLPLSGWAADCPELLQGQLTKLRSKENIDLCQRYAGKPLVVVNTASH
CGFTPQFKGLEALYQRYKGQGLEVLGVPSDDFKQEAADTAETAKICYGNYGVTFAMTQPQ
HVRGDEAIPLFRQLAEQSGQAPRWNFYKYVVDRQGRVVAQFSSKTTPDDPQLQAAIEKAI
ASQP
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctcgcgtgctgttgtccgtcctggcgctcgccgggctgccgctgagcggctgg
gccgccgattgcccggaactgttgcagggccagttgaccaagctgcgttccaaggaaaac
atcgatctttgccagcgttacgccggcaagccgctggtggtggtcaacactgccagccac
tgtggcttcaccccgcagttcaaggggctcgaggcgctctaccagcgttacaaggggcag
ggcctggaagtgctcggggtaccttccgacgacttcaagcaggaagccgcggataccgcc
gagaccgcgaagatctgctatggcaactacggcgtgaccttcgccatgacccagccgcag
cacgttcgcggcgacgaggcgatcccgctgttccgccagttggccgagcagagcggccag
gcgccgcgctggaatttctacaagtacgtggtggatcgccagggcagggtggtcgcgcag
ttctccagcaagaccaccccggacgatccgcagctccaggccgccatcgagaaggccatc
gccagccagccctga

DBGET integrated database retrieval system