KEGG   Pseudomonas aeruginosa SCV20265: SCV20265_2705Help
Entry
SCV20265_2705     CDS       T02971                                 

Definition
(GenBank) Acetyl-CoA C-acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
paes  Pseudomonas aeruginosa SCV20265
Pathway
paes00071  Fatty acid degradation
paes00072  Synthesis and degradation of ketone bodies
paes00280  Valine, leucine and isoleucine degradation
paes00310  Lysine degradation
paes00362  Benzoate degradation
paes00380  Tryptophan metabolism
paes00620  Pyruvate metabolism
paes00630  Glyoxylate and dicarboxylate metabolism
paes00640  Propanoate metabolism
paes00650  Butanoate metabolism
paes00900  Terpenoid backbone biosynthesis
paes01100  Metabolic pathways
paes01110  Biosynthesis of secondary metabolites
paes01120  Microbial metabolism in diverse environments
paes01130  Biosynthesis of antibiotics
paes01200  Carbon metabolism
paes01212  Fatty acid metabolism
paes02020  Two-component system
Brite
KEGG Orthology (KO) [BR:paes00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SCV20265_2705
   00630 Glyoxylate and dicarboxylate metabolism
    SCV20265_2705
   00640 Propanoate metabolism
    SCV20265_2705
   00650 Butanoate metabolism
    SCV20265_2705
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SCV20265_2705
   00072 Synthesis and degradation of ketone bodies
    SCV20265_2705
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCV20265_2705
   00310 Lysine degradation
    SCV20265_2705
   00380 Tryptophan metabolism
    SCV20265_2705
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SCV20265_2705
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SCV20265_2705
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SCV20265_2705
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:paes04147]
    SCV20265_2705
Enzymes [BR:paes01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SCV20265_2705
Exosome [BR:paes04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SCV20265_2705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AHC76819
Position
2812045..2813235
Genome map
AA seq 396 aa AA seqDB search
MTREDPIVIVSAVRTPMGGFLGDFKDVNAATLGAAAVRAAVERARLQADEVDEAVLGCVL
AAGQGQAPARQAVLGAGLARGTPCSTLNKMCGSGMKALMLAHDTLLAGSAGVALAGGMES
MSNAPYLLERARSGYRMGHGKVLDHMFLDGLEDAYDKGRLMGTFAEDCAEAYGFTREAQD
EFAVASLTRAQQAMRDGRFQAEIVPLTVTAGKTERLVDSDEQPPKARLDKIPTLKPAFRE
GGTVTAANSSSISDGAAALVLMRLSEAERRGLAPLAAIRGHASFADAPNLFPTAPVGAVK
RLMQRTGWSLGEVDLFEVNEAFAVVGMAAMRDLDLSHERLNVHGGACALGHPIGASGARI
VVTLLNALQQYDLERGVAAVCIGGGEATAIAVERLR
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcgaagatccgatcgtcatcgtcagcgccgtccgcaccccgatgggcggcttc
ctcggcgacttcaaggacgtcaacgccgctaccctcggtgccgcggcggtgcgcgccgcg
gtggagcgggcgcgcctgcaagccgacgaagtggacgaggccgtgctcggctgcgtgctc
gccgccggccagggccaggcgccggcgcgccaggcggtgcttggcgccggactggcgcgc
ggcacgccgtgctcgacgctgaacaagatgtgcggctcgggcatgaaggcgctgatgctc
gcccatgacacgttgctcgccggcagcgccggggtcgcgctggccgggggcatggaaagc
atgtccaacgcgccctacctgctggagcgcgcccgtagcggctaccgcatgggccacggc
aaggtgctcgaccacatgttcctcgacggcctcgaagacgcctacgacaagggccgcctg
atgggcaccttcgccgaggactgtgccgaggcctacggcttcacccgcgaagcacaggac
gagttcgccgtggcctcgctgacccgcgcgcagcaagccatgcgcgacgggcgcttccag
gccgagatcgtgccgctgacggtcaccgccggcaagaccgagcgcctggtggatagcgac
gagcagccgccgaaggcccggctggacaagatcccgaccctgaagccggcgttccgcgaa
ggcggcacggtgaccgcggccaactccagttcgatttccgacggcgccgccgcgctggtc
ctgatgcgcctttccgaggccgagcgacgcgggctcgcgccgttggcggcgattcgtggg
catgcttcgttcgccgacgcgccgaacctgttccccaccgcgccggtcggtgcggtgaag
cgcctgatgcagcgtaccggctggtcgctgggcgaggtcgacctgttcgaggtcaacgaa
gccttcgccgtggtcggcatggcggcaatgcgcgacctcgacctgtcccacgagcgcctc
aacgtccacggcggcgcctgtgcgctgggccatccgatcggcgcgtccggcgcgcggatc
gtcgtgaccctgctcaacgccctgcagcagtacgacctggaacgcggcgtggcggcggtc
tgcatcggcggcggcgaggcgaccgcgatcgccgtcgagcgcttgcgctga

DBGET integrated database retrieval system