KEGG   Pseudomonas aeruginosa SCV20265: SCV20265_4653Help
Entry
SCV20265_4653     CDS       T02971                                 

Definition
(GenBank) Phenylalanine-4-hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
paes  Pseudomonas aeruginosa SCV20265
Pathway
paes00360  Phenylalanine metabolism
paes00400  Phenylalanine, tyrosine and tryptophan biosynthesis
paes00790  Folate biosynthesis
paes01100  Metabolic pathways
paes01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:paes00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    SCV20265_4653
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCV20265_4653
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SCV20265_4653
Enzymes [BR:paes01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     SCV20265_4653
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AHC78761
Position
4923356..4924144
Genome map
AA seq 262 aa AA seqDB search
MKTTQYVARQPDDNGFIHYPETEHQVWNTLITRQLKVIEGRACQEYLDGIEQLGLPHDRI
PQLDEINRVLQATTGWRVARVPALIPFQTFFELLASQQFPVATFIRTPEELDYLQEPDIF
HEIFGHCPLLTNPWFAEFTHTYGKLGLKASKEERVFLARLYWMTIEFGLVETDQGKRIYG
GGILSSPKETVYSLSDEPLHQAFNPLEAMRTPYRIDILQPLYFVLPDLKRLFQLAQEDIM
ALVHEAMRLGLHAPLFPPKQAA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgacgcagtacgtggcccgccagcccgacgacaacggtttcatccactatccg
gaaaccgagcaccaggtctggaataccctgatcacccggcaactgaaggtgatcgaaggc
cgcgcctgtcaggaatacctcgacggcatcgaacagctcggcctgccccacgaccggatc
ccccagctcgacgagatcaacagggttctccaggccaccaccggctggcgcgtggcgcgg
gttccggcgctgattccgttccagaccttcttcgaactgctggccagccagcaattcccc
gtcgccaccttcatccgcaccccggaagaactggactacctgcaggagccggacatcttc
cacgagatcttcggccactgcccactgctgaccaacccctggttcgccgagttcacccat
acctacggcaagctcggcctcaaggcgagcaaggaggaacgcgtgttcctcgcccgcctg
tactggatgaccatcgagttcggcctggtcgagaccgaccagggcaagcgcatctacggc
ggcggcatcctctcctcgccgaaggagaccgtctacagcctctccgacgagccgctgcac
caggccttcaatccgctggaggcgatgcgcacgccctaccgcatcgacatcctgcaaccg
ctctatttcgtcctgcccgacctcaagcgcctgttccaactggcccaggaagacatcatg
gcgctggtccacgaggccatgcgcctgggcctgcacgcgccgctgttcccgcccaagcag
gcggcctga

DBGET integrated database retrieval system