KEGG   Pseudomonas aeruginosa SCV20265: SCV20265_4713Help
Entry
SCV20265_4713     CDS       T02971                                 

Definition
(GenBank) putative haloacid dehalogenase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
paes  Pseudomonas aeruginosa SCV20265
Pathway
paes00361  Chlorocyclohexane and chlorobenzene degradation
paes00625  Chloroalkane and chloroalkene degradation
paes01100  Metabolic pathways
paes01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:paes00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SCV20265_4713
   00361 Chlorocyclohexane and chlorobenzene degradation
    SCV20265_4713
Enzymes [BR:paes01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     SCV20265_4713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: AHC78821
Structure
PDB: 

Position
4985598..4986299
Genome map
AA seq 233 aa AA seqDB search
MRAILFDVFGTLVDWRSSLIEQFQALERELGGTLPCVELTDRWRQQYKPAMDRVRNGQAP
WQHLDQLHRQSLEALAGEFGLALDEALLQRITGFWHRLRPWPDTLAGMHALKADYWLAAL
SNGNTALMLDVARHAGLPWDMLLCADLFGHYKPDPQVYLGACRLLDLPPQEVMLCAAHNY
DLKAARALGLKTAFIARPLEYGPGQSQDLAAEQDWDLIASDLLDLHRQLAASA
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgatcctgttcgatgtgttcggtaccctggtggactggcgttccagcctgatc
gagcagttccaggcgttggagcgcgaactcggcgggaccctgccctgcgtggaactgacc
gaccgctggcgccagcaatacaagccggcgatggaccgggtacgcaacggccaggcgccc
tggcagcacctcgaccagttgcaccggcagagtctcgaggccctggccggagagttcggc
ctggcgctggacgaggccctgctgcaacgcatcactggcttctggcaccgcctgcggccg
tggccggacacgctcgccgggatgcacgcgctgaaggccgactactggctcgccgcgctg
agcaacggcaacaccgcgctgatgctcgacgtcgcgcggcacgccgggctgccctgggac
atgctgctgtgcgccgacctgttcggccactacaagcccgacccgcaggtctacctcggc
gcctgccgcctgctcgacctgccgccgcaggaggtgatgctctgcgcggcgcacaactac
gacctcaaggccgcgcgcgccctcggcctgaagaccgcgttcatcgcccggccgctggaa
tacggccccggccagtcccaggacctcgccgccgagcaggactgggacctgatcgccagc
gacctgctggacctgcaccggcaactggcggcctcggcctga

DBGET integrated database retrieval system