KEGG   Pseudomonas aeruginosa SCV20265: SCV20265_5102Help
Entry
SCV20265_5102     CDS       T02971                                 

Definition
(GenBank) putative amidohydrolase / Aliphatic amidase AmiE
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
paes  Pseudomonas aeruginosa SCV20265
Brite
KEGG Orthology (KO) [BR:paes00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SCV20265_5102
Enzymes [BR:paes01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     SCV20265_5102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase DUF3875
Motif
Other DBs
NCBI-ProteinID: AHC79208
Position
complement(5403577..5404425)
Genome map
AA seq 282 aa AA seqDB search
MSIAVIQMVSQDDVTANLAAARRLLEQAAEGGARLAVLPENFAAMGRRDLAELGRAEARG
NGPILPWLNSAARDLRLWIVAGTLPLPPEGQPEAKANACSLLIDEHGERVARYDKLHLFD
VDVADARGRYRESDDYAFGQKIVVADTPVGRLGLTVCYDLRFPELYTALREAGAELITAP
SAFTAVTGAAHWQVLVRARAIETQCYLLAAGQGGVHPRGRETFGHSAIVDPWGRVLVERP
QGEAVLLAARDAAEQADIRRRMPVVAHRRFFPPAEPRPARTE
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgtccattgccgtgatccagatggtcagccaggacgacgtgacggccaacctggccgcc
gcccgtcgcctgctggaacaggccgccgagggcggggcgcggctcgccgtgctaccggaa
aacttcgccgccatgggccggcgcgacctggccgagctggggcgcgccgaggcgcggggg
aacgggcctatcctgccgtggttgaattccgccgctcgcgacctcaggttgtggatagtc
gccggaacgctgccgctgccgccggaggggcaacccgaggcgaaggcgaatgcctgttcg
ctgctgattgacgagcacggagagcgggtcgcccgctacgacaagctgcacctgttcgat
gtggacgtagccgatgcgcggggccgctatcgtgaatccgacgactatgctttcggtcag
aagatcgtggtggcggatacgccggtcggtcgccttggcctgacggtctgctacgacctg
cgttttccggaactctataccgcgctgcgcgaggccggcgcagagctgatcacagcgccg
tcggcgttcaccgcggtgaccggcgcggcgcactggcaggtgctggtccgcgcccgcgcc
atcgagacccagtgctacctgctggcggccggacagggtggcgtccacccacggggccgg
gagacgttcggccattcggccatcgtcgatccctggggccgggtcctggtcgagcggccg
cagggcgaagcggtgctgctggcggcgcgcgacgccgcagaacaggcggatatccgccgg
cgcatgccggtggtggcgcacagacgatttttcccgccggccgaaccgcggccggcgcgt
acggagtga

DBGET integrated database retrieval system