KEGG   Pseudomonas aeruginosa SCV20265: SCV20265_5109Help
Entry
SCV20265_5109     CDS       T02971                                 

Definition
(GenBank) Aspartyl-tRNA(Asn) amidotransferase subunit C/Glutamyl-tRNA(Gln) amidotransferase subunit C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
paes  Pseudomonas aeruginosa SCV20265
Pathway
paes00970  Aminoacyl-tRNA biosynthesis
paes01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paes00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SCV20265_5109
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:paes03029]
    SCV20265_5109
Enzymes [BR:paes01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     SCV20265_5109
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     SCV20265_5109
Mitochondrial biogenesis [BR:paes03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    SCV20265_5109
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-ProteinID: AHC79215
Structure
PDB: 

Position
5413348..5413638
Genome map
AA seq 96 aa AA seqDB search
MALERSDVEKIAHLARLGLSEADLPRTTETLNNILGLIDQMQAVDTSGVEPLAHPLEATQ
RLRPDAVTETDHRDAYQTIAPAVEEGLYLVPKVIES
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttgaacgctccgacgtggaaaaaatcgcccatctcgcccgcctgggcctgagc
gaggccgatcttccgcgcaccaccgagaccctgaacaacatcctcggcctgatcgaccag
atgcaggcggtcgacaccagcggcgtcgaaccgctcgcccatccgctggaagccacccag
cgcctgcgcccggacgcggtcaccgagaccgatcaccgcgacgcctaccagaccatcgcc
cccgccgtggaagaaggtctgtacctggttccgaaagtcatcgagtcataa

DBGET integrated database retrieval system