KEGG   Pseudomonas aeruginosa SCV20265: SCV20265_5300Help
Entry
SCV20265_5300     CDS       T02971                                 

Definition
(GenBank) Glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
paes  Pseudomonas aeruginosa SCV20265
Pathway
paes00471  D-Glutamine and D-glutamate metabolism
paes01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paes00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    SCV20265_5300
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:paes01011]
    SCV20265_5300
Enzymes [BR:paes01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     SCV20265_5300
Peptidoglycan biosynthesis and degradation proteins [BR:paes01011]
 Precursor biosynthesis
  Racemase
   SCV20265_5300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: AHC79406
Position
complement(5630840..5631637)
Genome map
AA seq 265 aa AA seqDB search
MAVESAAVGVFDSGVGGLSVLREIRARLPSESLLYVADNAHVPYGEKSAEYIRERCERIG
DFLLEQGAKALVLACNTATAAAAAELRERYPQVPLVAMEPAVKPAAAATRNGRVGVLATT
GTLKSARFAALLDRFASDVQVFIQPCPGLVERIEAGDLYGPQTRALLERLLAPILEQGCD
TLILGCTHYPFVKPLLAELIPAEMAVIDTGAAVARQLERVLSARALLASGQAATPRFWTS
ALPEEMERILPILWGSPESVGKLVV
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggcggttgagtcggccgcggtcggcgttttcgattccggggtcggcgggctcagcgta
ttgcgtgagattcgcgcgcgcctgccatccgaatcgttgctctacgtcgccgacaacgcc
catgtgccctacggcgagaagagcgcggagtacatccgcgaacgctgcgagcggatcggt
gatttccttctggagcagggcgccaaggctctggtactggcctgcaataccgcgacggct
gcggctgcggcggaattgcgcgaacgttatccgcaggtgccgctggtggccatggagcct
gcggtgaagccggccgcggcggccacccgcaacggtcgggtcggcgtcctggccaccacc
ggaactctgaagagcgcgcgtttcgccgccttgctcgaccgcttcgccagcgacgtacag
gtcttcatccagccctgcccggggctggtcgagcgcatcgaagccggcgatctctatggg
ccgcaaacccgggcactgctggaacgcctgctggcgcccatcctcgaacagggctgcgat
acgctgatcctcggctgtactcattatccctttgtcaaacccctgctggccgagctgatc
ccggcggagatggcggtgatcgatacgggagcggctgtcgcccggcagctggagcgcgta
ttgtcggcgcgggcgctactggcctctggccaggccgcgacgccgcgtttctggaccagc
gcgctgccggaggagatggaaaggatcctgccgatcctctggggaagcccggaaagcgta
ggaaaattagtcgtttag

DBGET integrated database retrieval system