KEGG   Pseudomonas aeruginosa SCV20265: SCV20265_5927Help
Entry
SCV20265_5927     CDS       T02971                                 

Definition
(GenBank) putative low-affinity inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
paes  Pseudomonas aeruginosa SCV20265
Brite
KEGG Orthology (KO) [BR:paes00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    SCV20265_5927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AHC80031
Position
complement(6313458..6314726)
Genome map
AA seq 422 aa AA seqDB search
MSLIADHGFAFLVLACLFGFFMAWGVGANDVANAMGTSVGSRALTIRQAILVAMVFEFCG
AYFAGGEVTETIRSGIVDPQYMTPDLLVFGMLSALLAAGVWLLLATIKGWPVSTTHSIVG
AIIGFASVGVSVHAVHWGAIGPIVASWVVTPVLSGLLAFALFRSVQWLVLHAEDPFRSAR
RYVPLYMFLAGFMVALMTVGKGLKHVGLELSGLQTLGLALLAGGLVMGLGIVLLLRIRPT
GGADPRGGFASVERVFAVLMIFTACSMAFAHGANDVANAIGPVAAVVAVVQAGGDLDLVS
RSPVPSWVLLLGAVGIVIGLATYGYRVIATIGREITELTPSRGFAAELATASTVVGASAI
GLPVSTTHTLVGAVLGIGMARGIGALNLRVIGSIFLSWVVTLPAGAVLAILFFLVLRALF
GA
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgatcgccgaccacggcttcgccttcctcgtactcgcctgcctgttcggtttc
ttcatggcctggggcgtcggcgccaacgacgtcgccaacgccatgggcacttcggtgggc
tcgcgcgctctgaccatccgccaggcgatcctggtggccatggtcttcgagttctgcggt
gcctatttcgctggtggcgaagtcaccgaaacgatcaggagcggcatcgtcgacccgcag
tacatgacccccgacctgctggtcttcggcatgctctcggccttgctggccgccggggtc
tggctgttgctggcgacgatcaagggctggccggtgtcgaccacccactccatcgtcggc
gcgatcatcggcttcgcctcggtcggtgtctcggtgcacgcggtgcactggggcgcgatc
ggcccgatcgtcgccagttgggtggtgacgccggtgctgtccgggctgctcgccttcgcc
ctgttcaggagcgtgcagtggctggtactgcatgccgaggacccgttccgcagcgcgcgc
cgctacgtgccgctgtacatgttcctggcgggcttcatggtcgcgctgatgaccgtcggc
aagggcctgaagcatgtcggcctggagctttccggcctccagacgctgggcctggcgttg
ctcgccggcggcctggtgatgggcctgggcatcgtcctgctgttgcgcatccgacccact
ggcggagccgatccgcgtggcggcttcgccagcgtcgagcgggtcttcgcggtgctgatg
atcttcaccgcctgctccatggctttcgcccatggtgccaacgacgtggccaacgccatc
ggcccggtggcggcggtcgtcgcggtggtccaggccggcggcgacctggatctggtgagc
cgttcgccggtgccgtcctgggtactgctgctgggcgcggtgggcatcgtcatcggcctg
gctacctatggctaccgggtgatcgccaccatcggccgggagatcaccgagctgaccccc
agccgcggcttcgccgccgagctggcgaccgcctccacggtggttggcgcctcggccatc
ggcctgcctgtatccaccacccataccctggtcggcgcggtgctcggcatcggcatggcg
cgcggcatcggcgcgctcaacctgcgggtgatcggctcgatcttcctgtcctgggtagtg
accctgccggccggcgcggtgctggcgatcctgttcttcctggtcctgcgcgcgctgttc
ggcgcctga

DBGET integrated database retrieval system