KEGG   Pseudomonas aeruginosa SCV20265: SCV20265_6178Help
Entry
SCV20265_6178     CDS       T02971                                 

Definition
(GenBank) Acetyl-CoA hydrolase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
paes  Pseudomonas aeruginosa SCV20265
Pathway
paes00020  Citrate cycle (TCA cycle)
paes00620  Pyruvate metabolism
paes00650  Butanoate metabolism
paes01100  Metabolic pathways
paes01110  Biosynthesis of secondary metabolites
paes01120  Microbial metabolism in diverse environments
paes01130  Biosynthesis of antibiotics
paes01200  Carbon metabolism
Module
paes_M00009  Citrate cycle (TCA cycle, Krebs cycle)
paes_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:paes00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCV20265_6178
   00620 Pyruvate metabolism
    SCV20265_6178
   00650 Butanoate metabolism
    SCV20265_6178
Enzymes [BR:paes01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     SCV20265_6178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CitF CoA_trans LUD_dom
Motif
Other DBs
NCBI-ProteinID: AHC80280
Structure
PDB: 

Position
6585567..6587060
Genome map
AA seq 497 aa AA seqDB search
MYRDRVRLPSLLDKVMSAAEAADLIQDGMTVGMSGFTRAGEAKAVPQALAMRAKERPLRI
SLMTGASLGNDLDKQLTEAGVLARRMPFQVDSTLRKAINAGEVMFIDQHLSETVEQLRNH
QLKLPDIAVIEAAAITEQGHIVPTTSVGNSASFAIFAKQVIVEINLAHSTNLEGLHDIYI
PTYRPTRTPIPLTRVDDRIGSTAIPIPPEKIVAIVINDQPDSPSTVLPPDGETQAIANHL
IDFFKREVDAGRMSNSLGPLQAGIGSIANAVMCGLIESPFENLTMYSEVLQDSTFDLIDA
GKLRFASGSSITLSPRRNADVFGNLERYKDKLVLRPQEISNHPEVVRRLGIIGINTALEF
DIYGNVNSTHVGGTKMMNGIGGSGDFARNAHLAIFVTKSIAKGGNISSVVPMVSHVDHTE
HDVDILVTEQGLADLRGLAPRERARVIIENCVHPSYQAPLLDYFEAACAKGGHTPHLLRE
ALAWHLNLEERGHMLAG
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgtgatcgcgtgcgcctgccctccctgctcgacaaggtgatgagtgcggccgaa
gccgccgacctgatccaggacggcatgaccgtcggcatgagcggtttcacccgcgccggc
gaggccaaggccgtaccccaggcgctggccatgcgcgccaaggaacgtccgctgcgtatc
agcctgatgaccggcgccagcctcggcaacgacctcgacaagcagctcaccgaggccggc
gtgctcgcccggcgcatgccgttccaggtcgacagcaccctgcgcaaggcgatcaacgcc
ggcgaagtgatgttcatcgaccagcacctctcggaaaccgtcgagcagttgcgcaaccac
cagctgaagctgccggacatcgccgtcatcgaagccgccgcgatcaccgagcagggccac
atcgtgccgaccacctcggtgggcaactcggcgagcttcgcgatcttcgccaagcaggtc
atcgtcgagatcaacctggcccacagcaccaacctggaaggcctgcacgacatctatatc
ccgacctaccggccgacccgcacgccgatcccgctgacccgcgtcgacgaccgcatcggc
agcacggcgatcccgatcccgccggagaagatcgtcgccatcgtcatcaacgaccagccg
gactcgccatccaccgtgctgccgccggacggcgagacccaggccatcgccaaccacctg
atcgatttcttcaagcgcgaggtcgacgccgggcgcatgagcaacagcctcggcccgctg
caggccggtatcggcagcatcgccaacgcggtgatgtgcggcctgatcgagtcgccgttc
gagaacctgaccatgtactccgaagtgctgcaggactcgaccttcgacctgatcgacgcc
ggcaagctgcgcttcgcctcgggcagctcgatcaccctgtcgccgcggcgcaacgccgac
gtgttcggtaacctggagcgctacaaggacaagctggtgctgcgcccgcaggaaatctcc
aaccaccccgaggtggtccgtcgcctgggcatcatcggcatcaatacggcgctggagttc
gacatctacggcaacgtcaactcgacccacgtcggcggcaccaagatgatgaacggcatc
ggcggctccggcgacttcgcccgcaacgcgcacctggcgatcttcgtcaccaagtcgatc
gccaagggcggcaacatttccagcgtggtgccgatggtcagccacgtcgaccacaccgag
cacgacgtcgacatcctcgtcaccgagcagggcctcgccgacctgcgcggcctggcgcct
cgcgaacgggcccgggtgatcatcgagaactgtgtccacccgtcctaccaggcaccgctg
ctggactacttcgaggcggcttgcgcgaaaggcggccacacgccgcatctgttgcgcgag
gcgctggcctggcacctgaacctggaagaacgcggacacatgctggccggctga

DBGET integrated database retrieval system