KEGG   Pseudomonas aeruginosa PA38182: BN889_01373Help
Entry
BN889_01373       CDS       T03031                                 

Definition
(GenBank) putative glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
paeu  Pseudomonas aeruginosa PA38182
Pathway
paeu00480  Glutathione metabolism
paeu00590  Arachidonic acid metabolism
paeu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paeu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    BN889_01373
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BN889_01373
Enzymes [BR:paeu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BN889_01373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: CDI89439
Position
1441020..1441574
Genome map
AA seq 184 aa AA seqDB search
MKPRVLLSALALAGLPLSGWAADCPELLQGQLTKLRSKESIDLCQRYAGKPLVVVNTASH
CGFTPQFKGLEALYQRYKGQGLEVLGVPSDDFKQEAADTAETAKICYGNYGVTFAMTQPQ
HVRGDEAIPLFRQLAEQSGQAPRWNFYKYVVDRQGRVVAQFSSKTTPDDPQLQAAIEKAI
ASQP
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctcgcgtgctgttgtccgccctggcgctcgccgggctgccgctgagcggctgg
gccgccgattgcccggaactgctgcagggccagttgaccaagctgcgttccaaggaaagc
atcgatctttgccaacgttacgccggcaagccgctggtggtggtcaacaccgccagccac
tgtggcttcaccccgcagttcaaggggcttgaggcgctctaccagcgctacaaggggcag
ggcctggaagtgctcggggtaccctccgacgacttcaagcaggaagccgcggataccgcc
gagaccgcgaagatctgctatggcaactacggcgtgaccttcgccatgacccagccgcag
cacgtgcgcggcgacgaggcgatcccgctgttccgccagttggccgagcagagcggccag
gcgccgcgctggaatttctacaagtacgtggtggatcgccagggcagggtggtcgcgcag
ttctctagcaagaccaccccggacgatccgcagctccaggctgccatcgagaaggccatc
gccagccagccctga

DBGET integrated database retrieval system