KEGG   Pseudomonas aeruginosa PA38182: BN889_03973Help
Entry
BN889_03973       CDS       T03031                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
paeu  Pseudomonas aeruginosa PA38182
Pathway
paeu00071  Fatty acid degradation
paeu00072  Synthesis and degradation of ketone bodies
paeu00280  Valine, leucine and isoleucine degradation
paeu00310  Lysine degradation
paeu00362  Benzoate degradation
paeu00380  Tryptophan metabolism
paeu00620  Pyruvate metabolism
paeu00630  Glyoxylate and dicarboxylate metabolism
paeu00640  Propanoate metabolism
paeu00650  Butanoate metabolism
paeu00900  Terpenoid backbone biosynthesis
paeu01100  Metabolic pathways
paeu01110  Biosynthesis of secondary metabolites
paeu01120  Microbial metabolism in diverse environments
paeu01130  Biosynthesis of antibiotics
paeu01200  Carbon metabolism
paeu01212  Fatty acid metabolism
paeu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:paeu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN889_03973
   00630 Glyoxylate and dicarboxylate metabolism
    BN889_03973
   00640 Propanoate metabolism
    BN889_03973
   00650 Butanoate metabolism
    BN889_03973
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BN889_03973
   00072 Synthesis and degradation of ketone bodies
    BN889_03973
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN889_03973
   00310 Lysine degradation
    BN889_03973
   00380 Tryptophan metabolism
    BN889_03973
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BN889_03973
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN889_03973
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BN889_03973
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:paeu04147]
    BN889_03973
Enzymes [BR:paeu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BN889_03973
Exosome [BR:paeu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BN889_03973
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CDI92006
Position
complement(4155245..4156432)
Genome map
AA seq 395 aa AA seqDB search
MLDAYIYAGLRTPFGRHAGALSTVRPDDLAGLLLARLAETSGFAVDDLEDVILGCTNQAG
EDSRNLARNALLAAGLPARLPGQTVNRLCASGLSAVIDAARAISCGEGRLYLAGGAESMS
RAPFVMGKAESAFSRTLEVFDSTIGARFANPRLVERYGNDSMPETGDNVARAFGIAREDA
DRFAASSQARYQAALEEGFFLGEILPVEVRAGRKGETRLVERDEHPRPQADLAALARLPA
LFAGGVVTAGNASGINDGAAVVLLGDRAIGEREGIRPLARILASASVGVEPRLMGIGPQQ
AILRALQRAGIDLDEVGLIEINEAFAPQVLACLKLLGLDYEDRGSIPMAAPLPSAIRSAP
PVRAWCSPPPAGCNASSGATRWSACASGSARAWRW
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatgcctatatctacgccggcctgcgtacgcctttcggccggcatgccggtgca
ctctcgacggtgcgtccggacgacctggccggcctgctgctggcgcgtctcgcggaaacc
tccgggttcgccgtcgacgacctggaggatgtgatcctcggttgcaccaaccaggccggc
gaagacagccgcaacctggcgcgcaacgcgctgctcgcagccggcctgccggcgcggctg
cccgggcagacggtcaaccgcttgtgtgccagcggactgtcggcggtgatcgacgcggcg
cgcgcgatcagttgcggcgagggtcggctgtacctggccggcggcgccgaaagcatgtcc
cgggcgccgttcgtcatgggcaaggcggagagcgccttcagccgcacgctggaggtcttc
gacagcaccatcggcgcgcgcttcgccaaccccaggctggtcgagcgctatggcaacgac
agcatgccggagaccggcgacaacgtggcccgcgccttcggcatcgcccgcgaagacgcc
gaccgtttcgccgcttcttcccaggcgcgctaccaggctgcgctggaggagggctttttc
ctcggcgagatccttccggtggaggtgcgtgccggacgcaagggcgagacgcggctggtg
gagcgcgacgagcatccgcggccgcaggccgacctggcggccctggcgcgcttgccggcg
ttgttcgccggcggggtagtgaccgccggcaatgcctcggggatcaacgacggggcggcg
gtagtgctgctgggcgaccgcgcgatcggcgagcgcgagggcatccggccgctggcgcgg
atcctcgccagcgccagcgtcggcgtggagccccggttgatgggcatcggcccgcagcag
gcgatcctccgcgcgctgcaacgcgccggcatcgacctggacgaggtcggcctgatcgag
atcaacgaagccttcgcgccgcaggtcctggcctgcctgaagttgctcggcctggactac
gaggaccgcgggtcaatccccatggcggcgccattgccctcggccatccgctcggcgcct
ccggtgcgcgcctggtgctcaccgccgcccgcgggctgcaacgcatcgagcggcgctacg
cggtggtcagcctgtgcgtcgggctcggccagggcgtggcgatggtga

DBGET integrated database retrieval system