KEGG   Pseudomonas aeruginosa PA38182: BN889_05792Help
Entry
BN889_05792       CDS       T03031                                 

Definition
(GenBank) putative phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
paeu  Pseudomonas aeruginosa PA38182
Brite
KEGG Orthology (KO) [BR:paeu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BN889_05792
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Ytca
Motif
Other DBs
NCBI-ProteinID: CDI93807
Position
complement(6050039..6050461)
Genome map
AA seq 140 aa AA seqDB search
MAAVVAVVQAGGDLDLVSRSPVPSWVLLLGAVGIVIGLATYGYRVIATIGREITELTPSR
GFAAELATASTVVGASAIGLPVSTTHTLVGAVLGIGMARGIGALNLRVIGSIFLSWVVTL
PAGAVLAILFFLVLRALFGA
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
gtggcggcggtcgtcgcggtggtccaggccggcggcgacctggatctggtgagccgttcg
ccggtgccgtcctgggtactgctgctgggcgcggtgggcatcgtcatcggcctggctacc
tatggctaccgggtgatcgccaccatcggccgggagatcaccgagctgacccccagccgc
ggcttcgccgccgagctggcgaccgcctccacggtggttggcgcctcggccatcggcctg
ccggtatccaccacccataccctggtcggcgcggtgctcggcatcggcatggcgcgcggc
atcggcgcgctcaacctgcgggtgatcggctcgatcttcctgtcctgggtagtgaccctg
ccggccggcgcggtgctggcgatcctgttcttcctggtcctgcgcgcgctgttcggcgcc
tga

DBGET integrated database retrieval system