KEGG   Pseudomonas aeruginosa PA38182: BN889_05793Help
Entry
BN889_05793       CDS       T03031                                 

Definition
(GenBank) putative phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
paeu  Pseudomonas aeruginosa PA38182
Brite
KEGG Orthology (KO) [BR:paeu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BN889_05793
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: CDI93808
Position
complement(6050410..6051306)
Genome map
AA seq 298 aa AA seqDB search
MSLIADHGFAFLVLACLFGFFMAWGVGANDVANAMGTSVGSRALTIRQAILVAMVFEFCG
AYFAGGEVTETIRSGIVDPQYMTPDLLVFGMLSALLAAGVWLLLATIKGWPVSTTHSIVG
AIIGFASVGVSVHAVHWGAIGPIVASWVVTPVLSGLLAFALFRSVQWLVLHAEDPFRSAR
RYVPLYMFLAGFMVALMTVGKGLKHVGLELSGLQTLGLALLAGGLVMGLGIVLLLRIRPT
GGADPRGGFASVERVFAVLMIFTACSMAFAHGANDVANAIGRWRRSSRWSRPAATWIW
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgatcgccgaccacggcttcgccttcctcgtactcgcctgcctgttcggtttc
ttcatggcctggggcgtcggcgccaacgacgtcgccaacgccatgggcacttcggtgggc
tcgcgcgctctgaccatccgccaggcgatcctggtggccatggtcttcgagttctgcggt
gcctatttcgctggtggcgaagtcaccgaaacgatcaggagcggcatcgtcgacccgcag
tacatgacccccgacctgctggtcttcggcatgctctcggccttgctggccgccggggtc
tggctgttgctggcgacgatcaagggctggccggtgtcgaccacccactccatcgtcggc
gcgatcatcggcttcgcctcggtcggtgtctcggtgcacgcggtgcactggggcgcgatc
ggcccgatcgtcgccagttgggtggtgacgccggtgctgtccgggctgctcgccttcgcc
ctgttcaggagcgtgcagtggctggtactgcatgccgaggacccgttccgcagcgcgcgc
cgctacgtgccgctgtacatgttcctggcgggcttcatggtcgcgctgatgaccgtcggc
aagggcctgaagcatgtcggcctggagctttccggcctccagacgctgggtctggcgttg
ctcgccggcggcctggtgatgggcctgggtatcgtcctgctgttgcgtatccgacccact
ggcggagccgatccgcgtggcggcttcgccagcgtcgagcgggtcttcgcggtgctgatg
atcttcaccgcctgctccatggctttcgcccatggtgccaacgacgtggccaacgccatc
ggccggtggcggcggtcgtcgcggtggtccaggccggcggcgacctggatctggtga

DBGET integrated database retrieval system