KEGG   Pseudomonas aeruginosa PA38182: BN889_06697Help
Entry
BN889_06697       CDS       T03031                                 

Definition
(GenBank) putative alcohol dehydrogenase (Zn-dependent)
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
paeu  Pseudomonas aeruginosa PA38182
Pathway
paeu00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:paeu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BN889_06697
Enzymes [BR:paeu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BN889_06697
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BN889_06697
    1.1.1.-  
     BN889_06697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N DZR UDPG_MGDP_dh_N Glu_dehyd_C
Motif
Other DBs
NCBI-ProteinID: CDI94703
Position
complement(6960429..6961130)
Genome map
AA seq 233 aa AA seqDB search
MKALRWHAARDLRLSELERQAPRPGEVELEVAYCGICGSDLHEYQSGPHSIPQAEAHPLS
GCRAPLTLGHEFCGVVAALGPGVEGLRIGDRVAVEPEYRCGECRYCREGRYNLCESMGFI
GLMGDGGFAERARVPAYMLHRLPDAVGFRQAAVLEPAAVALHALRRSSLAPGQRCAVFGL
GPIGLLLVMLARLRGIEDIVAIDVSPERLALAGEFGASRALDARDGDTVSASA
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcactgcgctggcacgctgcccgcgacctccgcctgagcgaactggaacgccag
gcgccgcggcccggcgaagtcgaactggaagtcgcctactgcggcatctgcggcagcgac
ctgcacgaataccagagcggcccgcactcgattccccaggccgaggcgcacccgctgtcc
ggttgccgcgcgccgctaaccctcggccatgagttctgcggcgtggtcgccgcgctcggc
cctggcgtggagggactgcgcatcggcgaccgcgtcgcggtggagccggaataccgctgc
ggcgaatgccgctactgccgggaaggccgctacaacctctgcgagtcgatgggcttcatc
ggcctgatgggcgacggcggcttcgccgagcgcgcgcgggtgccggcctacatgctgcac
cgcctgccggacgcggtgggcttccgccaggccgccgtgctcgaaccggccgccgtggcc
ctgcacgcgctgcgccgcagcagcctggcgccgggccagcgctgcgcggtgttcgggctc
ggcccgatcggcctgctgctggtgatgctcgcccgcctgcgcggaatcgaggacatcgtc
gcgatcgacgtcagtcccgagcgcctcgccctggccggggagttcggcgccagccgggcg
ctcgacgcccgcgacggcgacacggtgtctgcttctgcttga

DBGET integrated database retrieval system