KEGG   Pseudomonas aeruginosa PAO1-VE13: N297_2290Help
Entry
N297_2290         CDS       T03097                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
paev  Pseudomonas aeruginosa PAO1-VE13
Pathway
paev00040  Pentose and glucuronate interconversions
paev00053  Ascorbate and aldarate metabolism
paev01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paev00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    N297_2290
   00053 Ascorbate and aldarate metabolism
    N297_2290
Enzymes [BR:paev01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     N297_2290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AGY73192
Position
2437423..2439006
Genome map
AA seq 527 aa AA seqDB search
MTAILGHNFIGGARSAAGTLFLQSLDAASGEALPYRFVQATPEEVDAAAEAAASAYPHYR
QLPASRRAEFLDTIAAELDALDDDFVAIVCRETALPATRIQGERSRTSGQLRLFAEVLRR
GDFHGARIDRARPERKPLPRVDLRQCRIGLGPVAVFGASNFPLAFSTAGGDTAAALAAGC
PVVFKAHSGHMATAERVAAAILRAAERTGMPAGVFNMIYGGGVGERLVRHPAIQAVGFTG
SLKGGRALCDMAAARAQPIPVFAEMSSINPVVLLPAALKKRGEAVADELSASVVLGCGQF
CTNPGLVIGIRSAQFSAFLERFAARMDDQPAQTMLNTGTLASYEKGLAALHAHPRVRHLA
GQPQEGRQARPQLFQADVSLLLEGDELLQEEVFGPASVVVEVADHAELKRALHGLHGQLT
ATLIAEAEDLASFADLVPLLEQKAGRLLLNGYPTGVEVCDAMVHGGPYPATSDARGTSVG
TLAIDRFLRPVCYQNYPDAWLPEALKDGNPLGIARLVDGIVTRAAVA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgacagccatcctcggacacaacttcatcggcggcgcccgcagcgcggccggcacgctc
ttcctgcaaagcctcgacgccgccagcggtgaggcgctgccgtaccgcttcgtgcaagcc
accccggaagaagtggacgccgccgccgaagccgccgccagcgcctacccgcactaccgg
caactgccggccagccgccgcgcggaattcctcgataccatcgccgccgaactcgacgcg
ctggacgatgatttcgtcgccatcgtctgccgtgaaaccgcgctaccggccacgcgcatc
cagggcgaacgcagccgcaccagcggccagctgcgcctgttcgccgaagtcctgcggcgc
ggcgacttccatggcgcgcgcatcgaccgcgcccggcccgaacgcaagccgctgccacgc
gtcgacctgcgccagtgccggatcggcctcggcccggtggcggtgttcggcgcgagcaac
ttccccctggcgttctccaccgccggcggcgataccgccgcggccctggccgccggctgc
ccggtggtgttcaaggcgcacagcggacacatggccaccgccgaacgggtcgccgcggcg
atcctccgcgcggccgagcgcaccggcatgccggcgggcgtattcaacatgatctacggc
ggcggagtaggggagcggctggtacgccaccccgcgatccaggcggtcggcttcaccggt
tcgctgaagggtggccgcgccctctgcgacatggcggccgcccgggcgcagccgatcccg
gtgttcgccgagatgagcagcatcaacccggtggtgctgctgccggcggcgctgaagaag
cgcggcgaggccgtggccgacgaactgagtgcctcggtggtgctcggctgcggccagttc
tgtaccaatcccgggctggtcatcggcatccgctctgcgcaattctcggcgttcctcgaa
cgcttcgccgcccgcatggacgaccagccggcgcagaccatgctcaacaccggcacgctg
gccagctatgaaaaaggcctggcggcgctgcacgcccacccgcgcgtccgccatctcgcc
gggcaaccgcaggagggccgccaggcccggccgcaactgttccaggcggacgtcagcctg
ctgctggagggcgacgagttgctgcaggaagaagtcttcggcccggccagcgtggtcgtc
gaggtcgccgaccacgccgaactgaagcgcgcgctgcatgggctgcacgggcagctcacc
gcgaccctgatcgccgaagcggaagacctggcgtccttcgccgacctggtaccgctcctg
gaacagaaggcaggacgcctgctgctcaacggctacccgaccggcgtggaagtctgcgac
gcgatggtccacggcggcccgtacccggccacttcggacgcccgcggcacctcggtgggc
accctggccatcgaccgtttcctgcgcccggtgtgctaccagaactacccggacgcgtgg
ctgccggaagcgctgaaggatggcaacccattggggattgcgcggttggtggacgggatc
gtgacgcgggcggcggttgcttga

DBGET integrated database retrieval system