KEGG   Pseudomonas aeruginosa PAO1-VE13: N297_2544Help
Entry
N297_2544         CDS       T03097                                 

Gene name
maiA
Definition
(GenBank) maleylacetoacetate isomerase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
paev  Pseudomonas aeruginosa PAO1-VE13
Pathway
paev00350  Tyrosine metabolism
paev00643  Styrene degradation
paev01100  Metabolic pathways
paev01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:paev00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    N297_2544 (maiA)
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    N297_2544 (maiA)
Enzymes [BR:paev01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     N297_2544 (maiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 DUF599
Motif
Other DBs
NCBI-ProteinID: AGY73323
Structure
PDB: 

Position
2791215..2791859
Genome map
AA seq 214 aa AA seqDB search
MQLYSFFNSSTSYRVRIALALKGLDYQVVPVNLRQGEQLRPADRQRNPMGALPTLVDADG
RRFSQSLAIIDYLDAVQPEPRLIPLDPLHRAQALELALLVACDIHPLNNVRVLKYLTQVL
GIDAEDRQRWYAHWVAEGLAAAETLLNRHRRGAFFAGAAAGIVECCLVPQLANARRMGCD
LAPYPALLELEGRCLALEAFQRASPERQPDYLPD
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgcagctctacagcttcttcaacagctccacgtcctatcgggtgcgtatcgcattggcc
ctgaaaggcctggattaccaggtagtgccggtcaacctgcggcagggcgagcaactgcgc
ccggccgaccgccagcgcaacccgatgggcgcgctgccgaccctggtcgacgccgacggt
cgccggttcagccagtcgctggcgatcatcgactacctcgacgccgtgcagcccgaaccg
cgcctgatccctctcgacccactgcatcgcgcccaggcgctggaactggccctgctggtg
gcctgcgacatccatccgctgaacaacgtgcgggtgctcaagtacctgacccaggtcctc
ggcatagacgccgaggaccgccagcgctggtacgcgcactgggtcgccgagggcctggcg
gcggcggagaccctgctgaaccgacaccgtcgcggcgccttcttcgccggcgccgcagcg
ggcatcgtcgagtgctgcctggtaccgcaactggccaacgcccggcgcatgggctgtgac
ctggcgccctacccggcgttgctcgaactggaggggcgctgcctggcgctcgaagccttc
cagcgcgccagccccgagcgccagcccgactacctgccggactga

DBGET integrated database retrieval system