KEGG   Pseudomonas aeruginosa PAO1-VE13: N297_2626Help
Entry
N297_2626         CDS       T03097                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
paev  Pseudomonas aeruginosa PAO1-VE13
Pathway
paev00071  Fatty acid degradation
paev00072  Synthesis and degradation of ketone bodies
paev00280  Valine, leucine and isoleucine degradation
paev00310  Lysine degradation
paev00362  Benzoate degradation
paev00380  Tryptophan metabolism
paev00620  Pyruvate metabolism
paev00630  Glyoxylate and dicarboxylate metabolism
paev00640  Propanoate metabolism
paev00650  Butanoate metabolism
paev00900  Terpenoid backbone biosynthesis
paev01100  Metabolic pathways
paev01110  Biosynthesis of secondary metabolites
paev01120  Microbial metabolism in diverse environments
paev01130  Biosynthesis of antibiotics
paev01200  Carbon metabolism
paev01212  Fatty acid metabolism
paev02020  Two-component system
Brite
KEGG Orthology (KO) [BR:paev00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    N297_2626
   00630 Glyoxylate and dicarboxylate metabolism
    N297_2626
   00640 Propanoate metabolism
    N297_2626
   00650 Butanoate metabolism
    N297_2626
  09103 Lipid metabolism
   00071 Fatty acid degradation
    N297_2626
   00072 Synthesis and degradation of ketone bodies
    N297_2626
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    N297_2626
   00310 Lysine degradation
    N297_2626
   00380 Tryptophan metabolism
    N297_2626
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    N297_2626
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    N297_2626
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    N297_2626
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:paev04147]
    N297_2626
Enzymes [BR:paev01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     N297_2626
Exosome [BR:paev04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   N297_2626
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGY73182
Position
complement(2885357..2886547)
Genome map
AA seq 396 aa AA seqDB search
MTREDPIVIVSAVRTPMGGFLGDFKDVNAATLGAAAVRAAVERARLQADEVDEAVLGCVL
AAGQGQAPARQAVLGAGLARGTPCSTLNKMCGSGMKALMLAHDTLLAGSAGVALAGGMES
MSNAPYLLERARSGYRMGHGKVLDHMFLDGLEDAYDKGRLMGTFAEDCAEAYGFTREAQD
EFAVASLTRAQQAMRDGRFQAEIVPLTVTAGKTERLVDSDEQPPKARLDKIPTLKPAFRE
GGTVTAANSSSISDGAAALVLMRLSEAERRGLAPLAAIRGHASFADAPNLFPTAPVGAVK
RLMQRTGWSLGEVDLFEVNEAFAVVGMAAMRDLDLSHERLNVHGGACALGHPIGASGARI
VVTLLNALQQYDLERGVAAVCIGGGEATAIAVERLR
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcgaagatccgatcgtcatcgtcagcgccgtccgcaccccgatgggcggcttc
ctcggcgacttcaaggacgtcaacgccgctaccctcggtgccgcggcggtgcgcgccgcg
gtggagcgggcgcgcctgcaagccgacgaagtggacgaggccgtgctcggctgcgtgctc
gccgccggccagggccaggcgccggcgcgccaggcggtgcttggcgccggactggcgcgc
ggcacgccgtgctcgacgctgaacaagatgtgcggctcgggcatgaaggcgctgatgctc
gcccatgacacgttgctcgccggcagcgccggggtcgcgctggccgggggcatggaaagc
atgtccaacgcgccctacctgctggagcgcgcccgtagcggctaccgcatgggccacggc
aaggtgctcgaccacatgttcctcgacggcctcgaagacgcctacgacaagggccgcctg
atgggcaccttcgccgaggactgtgccgaggcctacggcttcacccgcgaagcacaggac
gagttcgccgtggcctcgctgacccgcgcgcagcaagccatgcgcgacgggcgcttccag
gccgagatcgtgccgctgacggtcaccgccggcaagaccgagcgcctggtggatagcgac
gagcagccgccgaaggcccggctggacaagatcccgaccctgaagccggcgttccgcgaa
ggcggcacggtgaccgcggccaactccagttcgatttccgacggcgccgccgcgctggtc
ctgatgcgcctttccgaggccgagcgacgcgggctcgcgccgttggcggcgattcgtggg
catgcttcgttcgccgacgcgccgaacctgttccccaccgcgccggtcggtgcggtgaag
cgcctgatgcagcgtaccggctggtcgctgggcgaggtcgacctgttcgaggtcaacgaa
gccttcgccgtggtcggcatggcggcaatgcgcgacctcgacctgtcccacgagcgcctc
aacgtccacggcggcgcctgtgcgctgggccatccgatcggcgcgtccggcgcgcggatc
gtcgtgaccctgctcaacgccctgcagcagtacgacctggaacgcggcgtggcggcggtc
tgcatcggcggcggcgaggcgaccgcgatcgccgtcgagcgcttgcgctga

DBGET integrated database retrieval system