KEGG   Pseudomonas aeruginosa PAO1-VE13: N297_3677Help
Entry
N297_3677         CDS       T03097                                 

Definition
(GenBank) 3-beta hydroxysteroid dehydrogenase/isomerase family protein
  KO
K10011  UDP-4-amino-4-deoxy-L-arabinose formyltransferase / UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating) [EC:2.1.2.13 1.1.1.305]
Organism
paev  Pseudomonas aeruginosa PAO1-VE13
Pathway
paev00520  Amino sugar and nucleotide sugar metabolism
paev01100  Metabolic pathways
paev01503  Cationic antimicrobial peptide (CAMP) resistance
Module
paev_M00761  Undecaprenylphosphate alpha-L-Ara4N biosynthesis, UDP-GlcA => undecaprenyl phosphate alpha-L-Ara4N
Brite
KEGG Orthology (KO) [BR:paev00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    N297_3677
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    N297_3677
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:paev01005]
    N297_3677
Enzymes [BR:paev01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.305  UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating)
     N297_3677
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.13  UDP-4-amino-4-deoxy-L-arabinose formyltransferase
     N297_3677
Lipopolysaccharide biosynthesis proteins [BR:paev01005]
 Unusual sugar
  N297_3677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase Formyl_trans_N GDP_Man_Dehyd Formyl_trans_C 3Beta_HSD NAD_binding_10 NAD_binding_4
Motif
Other DBs
NCBI-ProteinID: AGY72394
Position
3982016..3984004
Genome map
AA seq 662 aa AA seqDB search
MTSKAVVFAYHDIGCTGIEALLNAGYEIAAVFTHADDPRENTFYASVARLCAERGIPLHA
PEDVNHPLWLERIRQLRPDFLFSFYYRRLLGAELLACAARGAYNLHGSLLPRYRGRAPAN
WVLVNGETQTGVTLHRMIERADAGPILAQQAVAIDPEDTALSLHGKLRKAAGALLRDSLP
LLALGVLPEVEQDESQASHFGRRTPADGLLDWHRPARQLYDLVRAVTQPYPGAFCQVGEQ
KLIVWSAEVVAGNHGREPGSVLSCDPLRIACGEDSLVLRFGQRGERGLYLAGTQLATELG
LVEGARLRGAACSPQRRTRVLILGVNGFIGNHLSERLLRDGRYEVHGMDIGSDAIERLKA
DPHFHFVEGDIGIHSEWLEYHVKKCDVILPLVAIATPIEYTRNPLRVFELDFEENLRIVR
YCVKYGKRVVFPSTSEVYGMCQDPDFDEDRSNLVVGPINKQRWIYSVSKQLLDRVIWAYG
QQGLRFTLFRPFNWMGPRLDRLDSARIGSSRAITQLILHLVEGTPIRLVDGGAQKRCFTD
VDDGIEALARIIDNRDGRCDGQIVNIGNPDNEASIRQLGEELLRQFEAHPLRAQFPPFAG
FREVESRSFYGDGYQDVAHRKPSIDNARRLLDWQPTIELRETIGKTLDFFLHEALREREA
QA
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgaaagccgtcgtcttcgcctaccacgacatcggttgcaccggtatcgaagcc
ctgctcaatgccggctacgagatcgccgccgtcttcacccatgccgacgacccacgggaa
aacaccttctacgcctcggtcgcacgcctctgcgccgagcgcggcattccgctgcacgcg
cccgaggacgtgaaccatccgctgtggctggagcgtatccgccaactgcgcccggacttc
ctgttctccttctactaccgccgcctgctcggcgccgagctgctcgcctgcgccgcacgc
ggcgcctacaacctgcacggttcgctgctgccgcgctaccgcggacgcgccccggcgaac
tgggtgctggtcaacggcgaaacgcagaccggggtgaccctgcatcgcatgatcgagcgc
gccgacgccgggccgatcctcgcccagcaggccgtcgccatcgaccccgaggacaccgcc
ctgagcctgcacggcaagctgcgcaaggccgccggcgccctgctgcgcgacagcctgccg
ctgctcgccctcggcgtgctgccggaagtcgagcaggacgagagccaggccagccacttc
ggccggcgcaccccggcggacggcctgctcgactggcacaggccggcacggcagttgtac
gacctggtgcgcgcggtgacccagccctaccctggcgccttctgccaggtcggcgaacag
aagctgatcgtctggagcgccgaggtggtcgccggcaaccacggccgcgagccgggcagc
gtactgtcctgcgacccgctgcggatcgcctgcggcgaggactcgctggtgctgcgcttc
ggccagcgcggcgagcgcggcctgtacctggccggcacgcaactggccaccgagctgggc
ctggtcgagggcgcgcgcctgcgtggcgcggcatgcagtccgcagcgccgcacgcgggtg
ctgatcctcggggtcaacggcttcatcggcaaccacctgtccgaacgcctgctgcgcgac
ggtcgctacgaggtccacggcatggacatcggctccgacgccatcgaacggctcaaggcc
gacccgcatttccacttcgtcgaaggcgacatcggcatccattcggagtggctcgaatac
catgtgaagaaatgcgacgtgatcctgccgctggtggccatcgccacgcccatcgagtac
acgcgcaacccgctgcgggtgttcgaactggacttcgaggaaaacctgcggatcgtccgc
tactgcgtgaaatacggcaaacgcgtggtgttcccttccacctccgaggtctacggcatg
tgccaggacccggacttcgacgaagaccgctcgaacctggtggtcgggccgatcaacaag
cagcgctggatctactcggtgtccaagcagttgctcgaccgggtgatctgggcctacggc
cagcagggcctgcgcttcaccctgttccgtccgttcaactggatgggcccgcgcctggac
cgcctggattcggcgcggatcggcagctcgcgggcgatcacccagctcatcctgcacctg
gtcgaaggcacgccgatccgcctggtcgacggcggcgcgcagaagcgctgcttcaccgac
gtcgacgacggcatcgaggccctcgcgcggatcatcgacaaccgcgacggccgctgcgac
gggcagatcgtcaacatcggcaacccggacaacgaggcgagcatccgccagctcggcgag
gaactgctgcgccagttcgaggcccacccgctgcgcgcgcagttcccgcccttcgccggc
ttccgcgaggtggagagccgcagcttctacggcgacggctaccaggacgtggcccaccgc
aagccgagcatcgacaacgcccggcgcctgctcgactggcagcccaccatcgaactgcgc
gagaccatcggcaagaccctcgacttcttcctccacgaagcgctccgcgagcgcgaggca
caggcgtga

DBGET integrated database retrieval system