KEGG   Pseudomonas aeruginosa PAO1-VE13: N297_5378Help
Entry
N297_5378         CDS       T03097                                 

Definition
(GenBank) hypothetical protein
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
paev  Pseudomonas aeruginosa PAO1-VE13
Pathway
paev02020  Two-component system
Brite
KEGG Orthology (KO) [BR:paev00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    N297_5378
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:paev02022]
    N297_5378
Two-component system [BR:paev02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   N297_5378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ TusA DUF43 MEDS Phage_TAC_6
Motif
Other DBs
NCBI-ProteinID: AGY73978
Position
complement(5852648..5853391)
Genome map
AA seq 247 aa AA seqDB search
MSNPAALAEGEKILVVDDDARLRRLLERFLDEQGYRVRAVENTEQMDRLLSRELFQLVVL
DLMLPGEDGLTACRRLREQNNQVPIIMLTAKGDEGSRIQGLELGADDYLAKPFNPRELLA
RIKAVLRRQAPLVPGAPAGADEVVTFGDYQLFLATRELKKGDEVHMLTTGEFAVLKALVQ
HAREPLTRDKLMNLARGREWDALERSIDVQISRLRRLIEPDPSKPRYIQTVWGVGYVFVP
DGNARKA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaccctgccgccctggccgaaggtgaaaagatcctcgtcgtcgacgacgacgcc
cgcctgcgccgcctgctcgaacgtttcctcgacgagcagggctaccgcgtccgcgcggtg
gagaacaccgagcagatggatcgccttctatcccgcgaactgttccagctggttgtgctc
gacctgatgcttcccggcgaggacggcctcactgcctgccgccgcctgcgcgaacagaac
aaccaggtgccgatcatcatgctcaccgccaagggcgacgagggcagccgcatccagggc
ctggaactgggcgccgacgactacctggccaagccgttcaacccgcgcgaactgctggcg
cggatcaaggccgtgctgcgccgccaggcgccgctggtgcccggcgcgcctgccggtgcc
gacgaggtggtgaccttcggcgactaccagctgttcctcgccacccgcgaactgaagaag
ggcgacgaggtacacatgctgaccaccggcgagttcgccgtgctcaaggccctggtgcag
cacgcccgcgaaccgctgacccgggacaagctgatgaacctcgcccgtggccgcgagtgg
gatgccctggagcgttccatcgacgtgcagatctcgcgcctgcgccggctgatcgagccg
gatccgtccaagccgcgctatatccagacggtctggggcgtcggctacgtgttcgtgccg
gacggcaacgcgcgcaaggcctga

DBGET integrated database retrieval system