KEGG   Pseudomonas aeruginosa PAO1-VE13: N297_871Help
Entry
N297_871          CDS       T03097                                 

Definition
(GenBank) phospholipase C, phosphocholine-specific
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
paev  Pseudomonas aeruginosa PAO1-VE13
Pathway
paev00562  Inositol phosphate metabolism
paev00564  Glycerophospholipid metabolism
paev00565  Ether lipid metabolism
paev01100  Metabolic pathways
paev01110  Biosynthesis of secondary metabolites
paev02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:paev00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    N297_871
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    N297_871
   00565 Ether lipid metabolism
    N297_871
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    N297_871
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:paev02042]
    N297_871
Enzymes [BR:paev01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     N297_871
Bacterial toxins [BR:paev02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   N297_871
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase DUF756 TAT_signal
Motif
Other DBs
NCBI-ProteinID: AGY72787
Position
complement(919258..921450)
Genome map
AA seq 730 aa AA seqDB search
MTENWKFRRRTFLKHGAQAATLAGLSGLFPETLRRALAVEPDIRTGTIQDVQHVVILMQE
NRSFDHYFGHLNGVRGFNDPRALKRQDGKPVWYQNYKYEFSPYHWDTKVTSAQWVSSQNH
EWSAFHAIWNQGRNDKWMAVQYPEAMGYFKRGDIPYYYALADAFTLCEAYHQSMMGPTNP
NRLYHMSGRAAPSGDGKDVHIGNDMGDGTIGASGTVDWTTYPERLSAAGVDWRVYQEGGY
RSSSLWYLYVDAYWKYRLQEQNNYDCNALAWFRNFKNAPRDSDLWQRAMLARGVDQLRKD
VQENTLPQVSWIVAPYCYCEHPWWGPSFGEYYVTRVLEALTSNPEVWARTVFILNYDEGD
GFYDHASAPVPPWKDGVGLSTVSTAGEIEVSSGLPIGLGHRVPLIAISPWSKGGKVSAEV
FDHTSVLRFLERRFGVVEENISPWRRAVCGDLTSLFDFQGAGDTQVAPDLTNVPQSDARK
EDAYWQQFYRPSPKYWSYEPKSLPGQEKGQRPTLAVPYQLHATLALDIAAGKLRLTLGND
GMSLPGNPQGHSAAVFQVQPREVGNPRFYTVTSYPVVQESGEELGRTLNDELDDLLDANG
RYAFEVHGPNGFFREFHGNLHLAAQMARPEVSVTYQRNGNLQLNIRNLGRLPCSVTVTPN
PAYTREGSRRYELEPNQAISEVWLLRSSQGWYDLSVTASNTEANYLRRLAGHVETGKPSR
SDPLLDIAAT
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaaactggaaattccgccgtcgaacctttctcaagcacggcgcccaggccgct
accctggccggcctttccgggctgttcccggagacgctccggcgcgccctggccgtcgag
ccggacatccgcaccggaaccatccaggacgtccagcacgtggtcatcctgatgcaggag
aaccgcagcttcgatcactacttcggccacctcaacggcgtccgcggcttcaacgaccct
cgcgcgctcaagcgccaggacggcaagccggtctggtaccagaactacaagtacgagttc
tccccctatcactgggataccaaggtcaccagcgcccagtgggtgagttcgcagaaccat
gaatggtcggccttccacgcgatctggaaccagggccgcaacgacaagtggatggcggtg
cagtaccccgaagccatgggctacttcaagcgcggcgacattccctactactacgccctg
gccgacgccttcaccctgtgcgaggcctaccaccagtcgatgatgggcccgaccaatccg
aaccgcctctaccacatgagcggacgcgccgcccccagcggcgacggcaaggacgtacac
atcggcaacgacatgggcgacggcaccatcggcgccagcggcacggtggactggaccacc
tatcccgagcggctaagcgccgctggcgtggactggcgggtctaccaggaaggcggctac
cgctcctcgtcactctggtacctgtacgtcgacgcctactggaaataccggctccaggag
cagaacaactacgactgcaacgccctcgcctggttcaggaacttcaagaacgctccgcgc
gattcggacctctggcagcgcgccatgctcgcccgcggcgtcgaccagttgcgcaaggat
gtgcaggagaacacgctgccgcaggtgtcgtggatcgtcgcgccctactgctactgcgag
catccctggtggggcccctcgttcggcgagtactacgtgacccgggtgctcgaggcgctg
accagcaaccccgaggtctgggccaggaccgtgttcatcctcaactacgacgagggcgac
ggcttctatgaccacgccagcgccccggtgccgccgtggaaggatggcgtcggcctttcc
acggtcagcaccgccggcgagatcgaggtatccagcgggctgcccatcgggctcggccac
cgcgtcccgctgatcgccatctcgccctggtcgaagggcggcaaggtcagcgccgaagtg
ttcgaccatacctcggtgctgcgcttcctcgaacgccgcttcggcgtcgtcgaggaaaac
atctcgccctggcggcgtgccgtctgcggcgacctgacttcgctgttcgacttccagggc
gcaggcgatacccaggtcgcccccgacctgaccaacgtcccgcagagcgacgcgcgcaag
gaggacgcctactggcagcagttctaccggcccagtcccaaatactggtcctacgagccc
aagagcctgcccggccaggaaaagggccagcgccctaccctcgcggtgccctaccagttg
cacgccacgctggccctcgacatcgccgccggcaagctgcgcctgaccctgggcaacgac
ggcatgagcctgccgggcaatccgcagggacactccgctgcggtattccaggtgcagccg
cgggaagtcggcaatccgcgcttctataccgtgaccagctatccggtggtccaggaaagc
ggagaggaactgggccggaccctcaacgacgaactcgacgacctgctcgacgccaacggc
cgctacgccttcgaggtgcacggccccaacggcttcttccgcgagttccacggcaacctg
catctcgccgcgcagatggcgcggcccgaggtatcggtcacctatcaacgcaacggcaac
ctgcagttgaacatccgcaatctcggccgcctgccgtgcagcgtgacggtgacgccgaac
ccggcctatacccgggagggcagccgtcgctatgaactcgaaccgaaccaggcgatcagt
gaagtgtggctgttacgcagcagccagggctggtacgacctcagcgtgaccgccagcaat
acggaagccaactatctccgccgcctggccggacacgtcgagaccggcaagccgagcagg
agcgatccattgctcgacatcgcagcgacctga

DBGET integrated database retrieval system