KEGG   Pseudomonas aeruginosa PAO1-VE13: N297_930Help
Entry
N297_930          CDS       T03097                                 

Definition
(GenBank) beta-eliminating lyase family protein
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
paev  Pseudomonas aeruginosa PAO1-VE13
Pathway
paev00260  Glycine, serine and threonine metabolism
paev01100  Metabolic pathways
paev01110  Biosynthesis of secondary metabolites
paev01120  Microbial metabolism in diverse environments
paev01130  Biosynthesis of antibiotics
paev01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:paev00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    N297_930
Enzymes [BR:paev01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     N297_930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AGY70434
Position
985692..986696
Genome map
AA seq 334 aa AA seqDB search
MPVIDLRSDTVTQPTAGMREAMAAAELGDDVYGEDPTVNRLEAELAARLGFAAALFVPTG
TMSNLLGLMAHCERGDEYIVGQQAHTYKYEGGGAAVLGSIQPQPIDGEADGSLHLDKVAA
AIKADDFHFARTRLLALENTMQGKVLPLDYLAAARAFTRARGLALHLDGARLYNAAVKLG
VDASEITRHFDSVSVCLSKGLGAPVGSVLCGSVELIGKARRWRKMVGGGMRQAGLLAAAG
LYALDHQVARLADDHANAARLGDGLRELGYAVEPVQTNMVYVDVGERAVALRDFLAERGV
RISAAARLRLVTHLDVSAESIGQVLDAFAAFRRS
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgtcatcgacctgcgcagcgacaccgtcacccagcccaccgccggcatgcgcgaa
gccatggccgcggccgaactgggcgacgacgtctatggcgaggaccccacggtcaaccgc
ctggaggccgaactggcggcgcgcctgggcttcgccgcggcgctcttcgtaccgaccggg
accatgagcaacctgctcggattgatggcccactgcgagcgcggcgacgaatacatcgtc
ggccagcaggcgcatacctacaaatacgagggcggcggtgccgcggtgctgggctcgatc
cagccgcagccgatcgacggcgaggccgacggatcgctccacctggacaaggtcgcggcg
gcgatcaaggccgacgatttccacttcgccaggacccgcctgctggccctggaaaacacc
atgcagggcaaggtgctgccgctcgactacctggccgcggcgcgcgccttcactcgcgcg
cgtggcctggccctgcacctggatggcgcgcgcctgtacaacgcggcggtgaagctgggc
gtagacgccagcgagatcacccgacacttcgactcggtgtcggtgtgcctgtccaagggc
ctcggtgcgccggtgggctcggtgctttgcggcagcgtcgaactgatcggcaaggcccgc
cgctggcgcaaaatggtcggcggcgggatgcgccaggccggcctgttggcggctgccgga
ctgtacgccctcgaccaccaggtggcacgcctggccgacgaccacgccaacgccgcgcgc
ctgggcgacgggctgcgcgaactgggctatgcggtggagccggtgcagaccaacatggtc
tacgtcgatgtcggcgagcgggcggtcgcgctgcgcgacttcctcgccgagcgcggggtg
cggatcagcgcggcggcgcgtttgcgcctggtcacccacctggacgtttccgccgagtcc
ataggacaagtactggatgccttcgcggcctttcgtcgctcataa

DBGET integrated database retrieval system