KEGG   Pseudomonas aeruginosa M18: PAM18_0084Help
Entry
PAM18_0084        CDS       T01973                                 

Definition
(GenBank) hypothetical protein
  KO
K11902  type VI secretion system protein ImpA
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:paf00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PAM18_0084
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:paf02044]
    PAM18_0084
Secretion system [BR:paf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PAM18_0084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImpA_N
Motif
Other DBs
NCBI-ProteinID: AEO72573
Position
98573..99607
Genome map
AA seq 344 aa AA seqDB search
MLDVPVLLAAVSPDSPCGDDLEYDAAFLELERIAQGQPERQMGDAVLPAEPPEWPRVRAL
ASELFGRSKDLRVANLLLQSNVALDGLDGLADGLLLVRELLGQYWDGVYPLLDADDDNDP
TFRINALTGLVAEPLLQLVWAIPLVRSRAFGPVNLRAALNAAGLQRFASETLSPEQIAGA
FADADADALAATRRALEGALEHALAIESGVAERVGSAQGLDLGPLRQLLRQALQVFDLYG
PQGADESLAPGAEAVADEQVGAAPVAAVAAPAPRASGEIANREDVLRQLDRLLEYYVRHE
PSSPVPVLLKRAKTLVTADFAEIVRNLIPDGISQFETLRGPESE
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
gtgctggatgtacccgttttgctggctgccgtatccccggactcgccctgtggcgacgat
ctggagtacgacgccgcgttcctcgaactcgaacgcatcgcccagggccaacccgagcgc
cagatgggcgatgccgtgctgcccgccgaaccaccggagtggccgcgcgtacgcgcgctg
gccagcgaactgttcggccgtagcaaggacctgcgggtagccaacctgctgctgcagagc
aacgtcgccctcgacggcctggacgggctcgccgacggcctgctgctggtccgcgagctg
ctcggccagtactgggacggcgtctatccgctgctcgacgccgatgacgacaacgacccc
accttccgtatcaacgccctcaccggcctggtcgccgaaccgctgctgcaactggtctgg
gcgatcccgctggtgcgctcgcgggcgttcggcccggtcaacctgcgcgccgcgctgaac
gccgccgggctgcaacgcttcgccagcgagaccctgagtcccgagcagatcgccggcgcc
ttcgccgatgccgacgccgatgcgctggccgccacccggcgcgccctggaaggcgccctg
gaacatgccctggccatcgagagcggcgtcgccgaacgggtcggctcggcccagggactc
gacctcggtccccttcgtcaactgctgcgccaggccctccaggtgttcgacctgtacggc
ccgcagggcgccgacgagtccttggcgccgggtgccgaggcggtcgccgacgagcaggtg
ggcgccgcgcctgtcgcagccgtcgccgcgccggcaccgcgagccagcggcgagatcgcc
aaccgcgaagacgtcctgcgccagctcgaccgcctgctcgagtattacgttcgccacgag
ccgtcgagcccggtgccggtgctgctcaagcgcgccaagacactggtgacggccgacttc
gccgaaatcgtgaggaatctcatccccgatgggatttcccagttcgaaaccctgcgaggc
ccggaaagcgagtaa

DBGET integrated database retrieval system