KEGG   Pseudomonas aeruginosa M18: PAM18_0101
Entry
PAM18_0101        CDS       T01973                                 

Definition
(GenBank) hypothetical protein
Organism
paf  Pseudomonas aeruginosa M18
SSDB
Motif
Pfam: Tox-GHH2 DUF4150 DUF4423
Other DBs
NCBI-ProteinID: AEO72590
Position
118613..119773
AA seq 386 aa
MANEVYANNMEISCKAASGKSIAAFPDVCFTPPQAPPTPLGVPIPYPNTGLSKDTTKGTR
TIRITRKEVMLKNKSYYKTSYGDEPGRAPKKGIVTSKIKGKVYFTSWSMNVKFESKNVVR
HLDLTTHNHASFPGNTPVWPYLDQATVDAGGGPCSNEVKKEKKDCADFKPHGSKDACAGL
GAGKPSGKKTSNEADRLADKVAARKCLTARRCALQPYKPNSCCPQQTAHHLIEASALHDK
GRGGKGSVPLKGISNYSENKAPCVCAEGVNQNVGTHGLMHTFQSAAAAKSRSGTLQLSNG
SSISAKKTTYGTAKRQSMAAMGKVFPQSKCSKECLSAQLDNYHKQCGINARTPIKAVETG
QTDVTAATQAIKTRNARLGATRSRVR
NT seq 1161 nt   +upstreamnt  +downstreamnt
atggccaacgaggtgtacgccaacaacatggagatctcctgcaaggcggcgagcggcaag
tccatcgcggccttcccggatgtctgcttcaccccgccgcaggcgccgccgacgccgttg
ggggtaccgatcccctaccccaataccggcctgtccaaggacaccaccaagggcacccgg
accattcgcatcacccgcaaggaggtgatgctgaagaacaagagctactacaagaccagc
tacggcgacgagccggggcgggcgccgaagaagggcatcgttaccagcaagatcaagggc
aaggtgtacttcacctcctggtcgatgaacgtcaagttcgaaagcaagaacgtggttcgc
cacctcgacctgaccacccacaaccacgcgtcctttcctggcaatacgccggtctggccc
tacctcgaccaggccaccgtcgatgctggtggtggaccgtgcagcaatgaagtgaagaag
gagaagaaggattgcgctgacttcaagccgcatggcagcaaggatgcctgcgctggcctt
ggcgcgggcaagccttccggcaagaagaccagcaacgaagctgaccgactggcagacaag
gtcgctgcccgaaaatgcctgaccgcgcgccggtgtgccctgcaaccgtacaagccgaac
agttgctgcccgcagcagaccgctcaccacctgatcgaggccagcgccttgcacgacaag
ggacgtggtggaaaaggctcggtacccctcaaggggatatccaactattcggagaacaag
gctccttgcgtctgcgcggagggcgtcaatcagaacgtgggtacccacggcctcatgcac
acgttccagagcgccgctgccgcgaagtcgcgcagtggaaccctgcaattgtccaatggc
agctccatctccgcgaagaagaccacctacggaacggcgaaacgtcaatccatggctgcc
atgggcaaggtctttccgcagtcgaaatgctcgaaggaatgtctgtccgctcagctcgac
aactatcacaagcagtgcggaatcaacgccagaacacccatcaaggccgttgaaaccggc
cagaccgacgtcacggctgcgacgcaggcgataaagacccgcaatgcgcgtcttggcgcc
acgaggagtcgagtccgctag

DBGET integrated database retrieval system