KEGG   Pseudomonas aeruginosa M18: PAM18_0784Help
Entry
PAM18_0784        CDS       T01973                                 

Definition
(GenBank) 2,3-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:paf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PAM18_0784
Enzymes [BR:paf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     PAM18_0784
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     PAM18_0784
    1.1.1.-  
     PAM18_0784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C DAO UDPG_MGDP_dh_N Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: AEO73273
Position
complement(861506..862597)
Genome map
AA seq 363 aa AA seqDB search
MNSSPQANAAMRAAVWHGRHDIRVEDVPLPAEPPPGWVQIRVHWCGICGSDLHEYLAGPV
FIPVEAPHPLTGLKDQCILGHEFSGEIVRLGNGVTSFAVGQAVAADACQHCGTCYYCRHG
LYNICENLAFTGLMNNGAFAEYVNVPANLLYALPAGFPSEAGALIEPLAVGMHAVKKAGS
LLGQNVVVVGAGTIGLSTIMCARAAGAAQVIALEMSSARKAKALEVGASQVLDPSRCDAL
GEIRALTGGLGADVSFECIGNKHTAKLAIDAIRKAGKCVLVGIFEEPSEFNFFELVSTEK
QLLGALAYNGEFADVIAFIADGRLDIAPLVTGRIGLEEIVERGFEELVNNKEHNVKIIVS
PGG
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaacagttccccgcaagccaacgcggcgatgcgcgccgccgtctggcacggccgccac
gatatccgcgtggaagacgtgccgctcccggccgagccgccgcccggctgggtgcagatc
cgcgtgcactggtgcggcatctgcggctccgacctgcacgaatacctggccggcccggta
ttcatccccgtggaggcgccgcacccgctcaccggcctcaaggatcaatgcatcctcggc
cacgagttcagcggcgaaatcgtccgcctcggcaacggcgtgaccagcttcgccgtcggc
caggcggtcgccgcagacgcctgccagcattgcggcacctgctactactgccggcatggg
ctgtacaacatctgcgagaacctggccttcaccgggctgatgaacaacggcgccttcgcc
gaatacgtcaacgtaccggccaacctgctctacgccctgccggccggatttcccagcgag
gccggcgcgctgatcgagccgctggcggtgggcatgcacgcggtgaagaaggccggcagc
ctgctcgggcagaacgtggtggtggtcggcgccggcaccatcggcctgagcaccatcatg
tgcgcgcgcgccgccggcgcggcacaggtgatcgccctggagatgtcctcggcgcgcaag
gccaaggccctggaggtcggcgccagccaggtgctcgacccctcgcggtgcgacgcccta
ggcgaaatccgcgccctcaccggcgggcttggcgccgacgtcagcttcgaatgcatcggc
aacaagcacaccgccaagctggccatcgatgccatccgcaaggccggcaaatgcgtgctt
gtgggaatcttcgaggagcccagtgaattcaatttcttcgagctggtttccaccgagaag
cagttgctcggggccctcgcctacaacggcgagttcgccgacgtgatcgccttcatagcc
gacggccgcctcgacatcgcaccgctggtgaccggtcgcatcggcctggaagaaatcgtc
gagcgcggtttcgaagagttggtgaacaacaaggagcacaacgtgaagatcatcgtctcg
ccgggcggctga

DBGET integrated database retrieval system