KEGG   Pseudomonas aeruginosa M18: PAM18_1396Help
Entry
PAM18_1396        CDS       T01973                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf00071  Fatty acid degradation
paf00072  Synthesis and degradation of ketone bodies
paf00280  Valine, leucine and isoleucine degradation
paf00310  Lysine degradation
paf00362  Benzoate degradation
paf00380  Tryptophan metabolism
paf00620  Pyruvate metabolism
paf00630  Glyoxylate and dicarboxylate metabolism
paf00640  Propanoate metabolism
paf00650  Butanoate metabolism
paf00900  Terpenoid backbone biosynthesis
paf01100  Metabolic pathways
paf01110  Biosynthesis of secondary metabolites
paf01120  Microbial metabolism in diverse environments
paf01130  Biosynthesis of antibiotics
paf01200  Carbon metabolism
paf01212  Fatty acid metabolism
paf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:paf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PAM18_1396
   00630 Glyoxylate and dicarboxylate metabolism
    PAM18_1396
   00640 Propanoate metabolism
    PAM18_1396
   00650 Butanoate metabolism
    PAM18_1396
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PAM18_1396
   00072 Synthesis and degradation of ketone bodies
    PAM18_1396
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PAM18_1396
   00310 Lysine degradation
    PAM18_1396
   00380 Tryptophan metabolism
    PAM18_1396
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PAM18_1396
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PAM18_1396
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PAM18_1396
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:paf04147]
    PAM18_1396
Enzymes [BR:paf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PAM18_1396
Exosome [BR:paf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PAM18_1396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEO73883
Position
1527436..1528641
Genome map
AA seq 401 aa AA seqDB search
MLDAYIYAGLRTPFGRHAGALSTVRPDDLAGLLLARLAETSGFAVDDLEDVILGCTNQAG
EDSRNLARNSLLAAGLPARLPGQTVNRLCASGLSAVIDAARAISCGEGRLYLAGGAESMS
RAPFVMGKAESAFSRTLEVFDSTIGARFANPRLVERYGNDSMPETGDNVARAFGIAREDA
DRFAASSQARYQAALEEGFFLGEILPVEVRAGRKGETRLVERDEHPRPQADLAALARLPA
LFAGGVVTAGNASGINDGAAVVLLGDRAIGEREGIRPLARILASASVGVEPRLMGIGPQQ
AILRALQRAGIDLDEVGLIEINEAFAPQVLACLKLLGLDYEDPRVNPHGGAIALGHPLGA
SGARLVLTAARGLQRIERRYAVVSLCVGLGQGVAMVIERCR
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatgcctatatctacgccggcctgcgtacgcctttcggccggcatgccggtgca
ctctcgacggtgcgtccggacgacctggccggcctgctgctggcgcgtctcgcggaaacc
tccgggttcgccgtcgacgacctggaggatgtgatcctcggttgcaccaaccaggccggc
gaagacagccgcaacctggcgcgcaactcgctgctcgcagccggcctgccggcgcggctg
cccgggcagacggtcaaccgcttgtgtgccagcggactgtcggcggtgatcgacgcggcg
cgcgcgatcagttgcggcgagggtcggctgtacctggccggcggcgccgaaagcatgtcc
cgggcgccgttcgtcatgggcaaggcggagagcgccttcagccgcacgctggaggtcttc
gacagcaccatcggcgcgcgcttcgccaaccccaggctggtcgagcgctatggcaacgac
agcatgccggagaccggcgacaacgtggcccgcgccttcggcatcgcccgcgaagacgcc
gaccgtttcgccgcttcttcccaggcgcgctaccaggctgcgctggaggagggctttttc
ctcggcgagatccttccggtggaggtgcgtgccggacgcaagggcgagacgcggctggtg
gagcgcgacgagcatccgcggccgcaggccgacctggcggccctggcgcgcttgccggcg
ttgttcgccggcggggtagtgaccgccggcaatgcctcggggatcaacgacggggcggcg
gtagtgctgctgggcgaccgcgcgatcggcgagcgcgagggcatccggccgctggcgcgg
atcctcgccagcgccagcgtcggcgtggagccccggttgatgggcatcggcccgcagcag
gcgatcctccgcgcgctgcaacgcgccggcatcgacctggacgaggtcggcctgatcgag
atcaacgaagccttcgcgccgcaggtcctggcctgcctgaagttgctcggcctggactac
gaggacccgcgggtcaatccccatggcggcgccattgccctcggccatccgctcggcgcc
tccggtgcgcgcctggtgctcaccgccgcccgcgggctgcaacgcatcgagcggcgctac
gcggtggtcagcctgtgcgtcgggctcggccagggcgtggcgatggtgatcgagcgctgc
cgatga

DBGET integrated database retrieval system