KEGG   Pseudomonas aeruginosa M18: PAM18_2189
Entry
PAM18_2189        CDS       T01973                                 

Definition
(GenBank) hypothetical protein
Organism
paf  Pseudomonas aeruginosa M18
SSDB
Other DBs
NCBI-ProteinID: AEO74672
Position
2386674..2387261
AA seq 195 aa
MSQLPIPLPLNESRWRYVTASGGGMTVAFLAGSGGSITLLSPEGENVSFRYGGVGGGIGL
GMRLPRFGKVNLNVKGKSVGGAGALEALPSTGTVLVADGLVGRDLSRGDFTGPCMYVELG
AGVIAGGSGTAILFGLDPKLLAAVALASASPLTAALGASMSRQLLQSFRGALLMAGVNVG
AQFGGGAAAYLGALF
NT seq 588 nt   +upstreamnt  +downstreamnt
atgtcgcaacttcccattcccttgcccctcaacgagagtcgctggcgctacgtgacggcc
agtggcggaggcatgaccgtggccttcctggcgggtagcggcggctccatcacgttgctc
tcgccggagggtgagaacgtgtccttccgctatggcggggtgggcggcgggatcggactg
ggcatgcgcctgccgcgcttcggcaaggtcaacctcaatgtcaagggcaagagcgttggc
ggggccggtgcgctggaggcgttgccgagcaccggaaccgtcttggtcgcggacggcctg
gtggggcgcgacctgtcccgcggcgacttcaccgggccctgcatgtacgtcgaactcggc
gcgggagtcatcgccggcggttcgggcacggcgattctcttcggcctcgatcccaagctg
ctggcggcggtggcgctggcgagcgcctcgccattgaccgccgcgctgggcgccagcatg
tcgcggcaattactgcaatcgttccgtggcgccctgttgatggccggggtcaacgtcggt
gcacagttcggcggcggcgcggcggcttacctgggggcgttgttctga

DBGET integrated database retrieval system