KEGG   Pseudomonas aeruginosa M18: PAM18_2673Help
Entry
PAM18_2673        CDS       T01973                                 

Definition
(GenBank) hypothetical protein
  KO
K11919  type VI secretion system lysozyme-related protein
Organism
paf  Pseudomonas aeruginosa M18
Brite
KEGG Orthology (KO) [BR:paf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:paf02044]
    PAM18_2673
Secretion system [BR:paf02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   PAM18_2673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GPW_gp25
Motif
Other DBs
NCBI-ProteinID: AEO75156
Position
complement(2975580..2976005)
Genome map
AA seq 141 aa AA seqDB search
MSGALPPLFERLSAEADERPAFDDRALAESVRGELLRLLNTRRPANARSGILAYGLADWT
AVQRLRAEDRRQLAREVRAAVEHFEPRLQLAEVEVEPDPGNPQRLRIQLGGSLRSGSRLT
PALFVIEQGSDGLEVCHERFD
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgtccggagccctgccgccgctgttcgagcgcctcagcgccgaggccgacgaacgtccc
gcgttcgacgaccgggcgctggccgagtcggtccgcggcgagctgctgcgcctgctcaac
acacggcgcccggcgaatgcgcgcagcggcatcctcgcctacgggctcgccgactggacc
gccgtgcaacgcctgcgcgccgaggaccggcgccagctggcgcgcgaggtgcgggcggcg
gtcgagcatttcgagccgcgcctgcaactggccgaggtcgaggtcgaacctgacccgggc
aatccgcagcgcctgcgtatccagctcggcggcagcctgcgcagcgggtcgcgcctgacg
cctgcgctattcgtcatcgaacagggcagcgatggcctcgaggtgtgccatgagcgattc
gattga

DBGET integrated database retrieval system