KEGG   Pseudomonas aeruginosa M18: PAM18_2679Help
Entry
PAM18_2679        CDS       T01973                                 

Definition
(GenBank) hypothetical protein
  KO
K11892  type VI secretion system protein ImpK
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:paf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PAM18_2679
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:paf02044]
    PAM18_2679
Secretion system [BR:paf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PAM18_2679
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DotU
Motif
Other DBs
NCBI-ProteinID: AEO75162
Position
2980735..2981493
Genome map
AA seq 252 aa AA seqDB search
MPEGSAGPFSQAYQEQPLSTAFRQAWQEWLEAWGALDRDAQDVPRMVERALELSTRITRR
LWRSAFASVGDAAGVQVKAMVYAFVALVDETLVFSAWPGQGAWQDKPLESHLYGSRQAGE
YLPLAIKRLLDERAPASRDLANVYLQCLILGFRGRLRGPRGEALHEKWRQALFAFAWQRE
ADAADLGRRLEQPAAAPPRRLPVRAALPDGFRLGLAVLGLVLLMSGIGHLFWRDIQHEMA
AVTHLADAEQAP
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaagggagtgcagggcctttttcccaggcgtaccaggagcaaccgctcagcacg
gcattccgccaggcctggcaggaatggctggaggcctggggcgccctcgaccgggacgcc
caggatgtgccacggatggtcgagcgcgccctcgaactgtccacccgcatcacccggcgt
ctgtggcgcagcgccttcgccagcgtcggcgacgcggcgggcgtgcaggtcaaggcgatg
gtctatgccttcgtcgccctggtcgacgagaccctggtcttcagcgcctggccggggcag
ggcgcctggcaggacaaaccgctggagtcgcatctctacggcagtcgccaggcgggcgaa
tacctgccgctggcgatcaagcgcctgctcgacgaacgcgccccggccagtcgcgacctg
gccaacgtctacctgcaatgcctgatcctcggcttccgcggtcgcctgcgcgggccgcgc
ggcgaggcgctgcacgagaagtggcggcaggcgttgttcgccttcgcctggcagcgcgag
gcggacgccgccgacctcggccgtcgccttgagcagcccgccgctgcgccgccacggcgt
ctgccggtgcgcgcagcgctgccggacggcttccgcctgggcctggcggtgctcgggctg
gtgctgttgatgagcggtatcggacacctgttctggcgcgacatccagcacgaaatggcg
gcggtgacccacctggccgatgcggagcaggcgccatga

DBGET integrated database retrieval system