KEGG   Pseudomonas aeruginosa M18: PAM18_3198
Entry
PAM18_3198        CDS       T01973                                 

Definition
(GenBank) hypothetical protein
Organism
paf  Pseudomonas aeruginosa M18
SSDB
Motif
Pfam: CHAP NLPC_P60
Other DBs
NCBI-ProteinID: AEO75681
Structure
PDB: 

Position
3575434..3575898
AA seq 154 aa
MDSLDQCIVNACKNSWDKSYLAGTPNKDNCSGFVQSVAAELGVPMPRGNANAMVDGLEQS
WTKLASGAEAAQKAAQGFLVIAGLKGRTYGHVAVVISGPLYRQKYPMCWCGSIAGAVGQS
QGLKSVGQVWNRTDRDRLNYYVYSLASCSLPRAS
NT seq 465 nt   +upstreamnt  +downstreamnt
atggacagtctcgatcaatgcatcgtcaacgcctgcaagaacagctgggacaagagctac
ctggccggcaccccgaacaaggacaactgttccggcttcgtccagtcggtggccgccgag
ctgggcgtaccgatgccccgcggcaacgccaacgccatggtcgacggcctggagcagagc
tggaccaagctcgcctccggcgccgaggccgcgcagaaggcggcccagggcttcctggtg
atcgccggcctgaagggccgcacctacgggcacgtcgcggtggtcatcagcggtccgctg
tatcggcagaagtacccgatgtgctggtgcggcagcatcgccggcgcggtcggccagagc
cagggcctgaagtcggtcggccaggtgtggaatcgcaccgaccgcgaccgcctcaactac
tacgtctactccctggccagttgcagcctgcccagggccagttga

DBGET integrated database retrieval system