KEGG   Pseudomonas aeruginosa M18: PAM18_3367
Entry
PAM18_3367        CDS       T01973                                 

Definition
(GenBank) putative hydrolase
  KO
K06889  uncharacterized protein
Organism
paf  Pseudomonas aeruginosa M18
Brite
KEGG Orthology (KO) [BR:paf00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    PAM18_3367
SSDB
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Abhydrolase_4 Glyco_transf_4 Abhydrolase_3
Other DBs
NCBI-ProteinID: AEO75850
Position
3749126..3750097
AA seq 323 aa
MPRALLALFCLLASLAHAAPNSILHRPYDLDTGHGVLRGSLLLPRSAVPPPVVLLVAGSG
PTDRDGNNPFGGNNRYLLRLAEALAERGIASVRYDKRGVARSLAAAPREEDLSVGVYVDD
VVAWSERLARDPRFSRLILVGHSEGALIASLAAPRTPAEELIAIAGSGQPIDRVLREQLR
GRLPPAQLRQADSVLASLKAGETRGDIPPALASLLRPSVQPYLISLFRKDPARAFGRLRI
PTLIVQGRNDIQVGVADAEALQRAKPDSQLVLIDGMNHILRIAPSTGLQQLSAYNDPNLP
LARQLVEAVSRFILRGAEAEKGR
NT seq 972 nt   +upstreamnt  +downstreamnt
atgccgcgcgccctcctcgccctgttctgcctgctcgccagcctggcccacgccgctccc
aacagcatcctgcaccgcccctacgacctggacaccgggcacggcgtgctgcgcggctcc
ttgctgctgccgcgcagcgccgtgccgccgccggtggtcctgctggtcgccggctccggt
cccaccgaccgcgacggcaacaaccccttcggcggcaacaaccgctacctgttgcgtctc
gccgaggccctggccgaacgcggaatcgccagcgtgcgctacgacaagcgtggagtcgcc
cgcagcctggcggcggcgccgcgcgaggaagacctcagcgtcggcgtctatgtcgacgac
gtggtcgcctggagcgaacggctggcccgcgacccgcgcttctcccggctgatcctggtc
ggccatagcgaaggcgcgctgatcgccagcctggcggcgcctcgcacgccggccgaggaa
ttgatcgccatcgccggcagcggccaacccatcgaccgggtgctgcgcgagcaactgcgc
ggtcgcctgccgccggcgcaactgcgccaggccgactcggtgctggcttcgctgaaggcc
ggcgagacccgcggcgatatcccgccggcgctcgccagcctgctccgccccagcgtgcag
ccgtacctgatctcgctgttccgcaaagacccggcccgcgcgttcggccgcctgcgcatc
ccgaccctgatcgtccagggccgcaatgacatccaggtcggcgtcgccgacgccgaggcg
ctccagcgagccaagcccgactcgcaactggtgctcatcgacggcatgaaccacatcctg
cggatcgccccgagcaccggtctccagcagctttccgcctacaacgacccgaacctgccg
ctggcccggcaactggtcgaggcggtcagccgcttcatcctgcgcggcgcagaggcggaa
aaaggccgctga

DBGET integrated database retrieval system