KEGG   Pseudomonas aeruginosa M18: PAM18_3368
Entry
PAM18_3368        CDS       T01973                                 

Definition
(GenBank) hypothetical protein
Organism
paf  Pseudomonas aeruginosa M18
SSDB
Motif
Pfam: DivIC
Other DBs
NCBI-ProteinID: AEO75851
Position
3750175..3750954
AA seq 259 aa
MIDSDTQPAAEEAEKKPPHPWAELAPEHFRLLRLAPLPTDRATGARPLRFVQLGRVERHS
ADQSLLRLSIQVPGLMLRKEQNLLEVWADHRNKEVRFGSDAGLSLEPLNRGLGRFLLAQA
IAWAQRRWAHYKVEGGALALKDGLTEDARLRRDHFIRAQGFDVSYEDQRLLKARYSAGRV
SELHSDWHKDKVQIVPLLDAAAMLEQAEQTLQAQDAEIRQLEQRINHYRRDDTSLRFTIA
CLTAFAVFQAGLLIWIATH
NT seq 780 nt   +upstreamnt  +downstreamnt
atgatcgatagcgatacccaaccggccgcagaagaagccgagaagaaaccgccgcacccc
tgggccgaactggcgccggagcatttccgcctgctccgcctggcgccactgcccaccgac
cgcgcgaccggcgcccgccccctgcgcttcgtccagctcggcagggtcgaacggcacagc
gcggaccagagcctgctgcgcctgagcatccaggtgccaggcctgatgctgcgcaaggag
cagaacctgctggaggtctgggccgatcatcgcaacaaggaagtgcgtttcggttcggac
gccgggctcagcctggaacccttgaatcgcgggctgggccgtttcctgctggcccaggcg
atcgcctgggcgcaacgacgctgggcccactacaaggtggaaggcggcgcactggcgctg
aaggatggcctgaccgaagacgcacgcctgcgccgcgaccatttcatccgcgcccagggc
ttcgacgtcagctatgaggaccagcggttgctcaaggcccgctacagcgccggccgggtc
agtgagctgcacagcgattggcacaaggacaaggtgcagatcgtgccgctgctggacgcc
gcggcgatgctggaacaggccgagcagaccctgcaggcccaggatgcggagatccgccaa
ctggaacagcgcatcaaccactaccgccgcgacgacaccagcctgcgcttcaccatcgcc
tgcctgaccgccttcgcggtgttccaggccggcctgctgatctggatcgccactcactga

DBGET integrated database retrieval system