KEGG   Pseudomonas aeruginosa M18: PAM18_3369
Entry
PAM18_3369        CDS       T01973                                 

Definition
(GenBank) N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
  KO
K07320  ribosomal protein L3 glutamine methyltransferase [EC:2.1.1.298]
Organism
paf  Pseudomonas aeruginosa M18
Brite
KEGG Orthology (KO) [BR:paf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:paf03009]
    PAM18_3369
Enzymes [BR:paf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.298  ribosomal protein L3 N5-glutamine methyltransferase
     PAM18_3369
Ribosome biogenesis [BR:paf03009]
 Prokaryotic type
  ribosomal protein modification factors
   PAM18_3369
SSDB
Motif
Pfam: MTS Methyltransf_31 Methyltransf_25 Methyltransf_23 Cons_hypoth95 PrmA Methyltransf_16 Methyltransf_18 PrmC_N Methyltransf_11 UPF0020 Methyltransf_15 PCMT Ubie_methyltran Met_10 TrmK Methyltransf_12
Other DBs
NCBI-ProteinID: AEO75852
Position
complement(3750979..3751893)
AA seq 304 aa
MSESRLLTLRDYIRWAVSRFHAAGLFFGHGTDNAWDEARHLVLGSLHLPWEISDSYLDCR
LEDDERAELAEILRRRIEERIPAAYLLGEAWFCGIPFSVDERVLVPRSPIAELIEQRFAP
WLPAEPARILDLCTGSGCIGIACAYAFEQAEVVLADLSFDALEVANVNIERHDLGERVYT
VQGDGFAGLPGQRFDLIVSNPPYVDAEDFADMPAEFHHEPELGLACGDDGLDLVRRMLAE
AADHLSEKGLLIVEVGNSEVHVQALYPEVDFTWLEFEHGGHGVFMLSAAQCREHRELFRS
RLEK
NT seq 915 nt   +upstreamnt  +downstreamnt
atgtccgagtcccgtctgctcaccctgcgcgactacatccgctgggctgtcagccgtttc
cacgccgccggcctgttcttcggtcacggcaccgacaatgcctgggacgaggcgcgccac
ctggttctgggctccctgcaccttccctgggaaatttctgacagctacctggattgtcgc
ctggaagacgatgaacgcgccgagttggcggagatcctccggcggcgcatcgaggaacgg
attccggcggcctacctgctgggcgaagcctggttctgcgggattcccttcagcgtcgac
gaacgcgtgctggtgccgcgctcgcctatcgccgaacttatcgaacagcgcttcgcgccc
tggctgccggccgagccggcgcgaatcctcgacctctgcaccggttccggctgcatcggc
atcgcctgcgcctatgcgttcgagcaggcggaggtggtgctcgccgacctgtccttcgat
gcgctggaggtggccaacgtcaatatcgagcgccacgacctcggcgagcgggtctacacc
gtccagggcgacggtttcgccgggctgcccggccagcgcttcgacctgatcgtgtccaat
ccgccctacgtggatgccgaggatttcgccgacatgccggcggagttccatcatgagcct
gaactcggcctggcctgcggcgacgacggcctggacctggtgcgacggatgctcgccgag
gcggccgaccacctcagcgagaaaggcctgctgatcgtcgaggtgggcaacagcgaggtc
catgtgcaggcgctgtatccggaagtggacttcacctggctggagttcgagcacggcggc
cacggggtgttcatgctgtccgccgcgcagtgccgcgagcaccgggaactgttccgttcg
cgcttggaaaagtga

DBGET integrated database retrieval system