KEGG   Pseudomonas aeruginosa M18: PAM18_3370
Entry
PAM18_3370        CDS       T01973                                 

Definition
(GenBank) putative hydrolase, isochorismatase family
Organism
paf  Pseudomonas aeruginosa M18
SSDB
Motif
Pfam: Isochorismatase DUF2325
Other DBs
NCBI-ProteinID: AEO75853
Position
3752064..3752660
AA seq 198 aa
MPHPLTLLQISGRGYPPAPLRQSTLLIIDAQEEYRSGALRLPGLDAAAAEIGVLVQAARA
SGTPIVHVRHLGIQGGLFDPQGPRGQFLPELQPEAGEKVVEKRLPNAFSGTELHDLLQNH
GRLDLIVCGFMTHSSVSTTVRAAKDYGYRCTLADSACATRDIPTLNGGVLSAADLQRAEI
AALGDNFAAIVAQARELL
NT seq 597 nt   +upstreamnt  +downstreamnt
atgcctcatccgctcacccttttgcagatcagcggacgcggctacccgccagcccccctt
cggcagagcaccttgctgatcatcgatgcccaggaagagtaccgcagcggcgccctgcgc
ctgccaggcctcgacgccgccgccgcggagatcggcgtgctggtgcaggcggcccgcgcc
agcggtacgcccatcgtgcatgtacgccacctgggtatccagggcggcctgttcgatccg
caagggccgcgcggccagttcctcccggaactgcaaccggaagccggggaaaaggtcgtg
gagaaacgcctgcccaatgccttctccggcaccgagctgcacgacctgctgcagaaccac
ggccgtctcgacctgatcgtctgcggcttcatgacccattccagcgtcagcaccaccgtg
cgcgcggccaaggactacggctaccgctgcaccctcgccgatagcgcctgcgccacccgc
gacatacccaccctgaacggcggggtcctgagcgccgcggacctgcaacgcgccgagatc
gccgccctcggcgacaacttcgcggcgatcgtcgcccaggcccgggaactgctctga

DBGET integrated database retrieval system