KEGG   Pseudomonas aeruginosa M18: PAM18_3372
Entry
PAM18_3372        CDS       T01973                                 

Definition
(GenBank) hypothetical protein
Organism
paf  Pseudomonas aeruginosa M18
SSDB
Motif
Pfam: Smr NdhM
Other DBs
NCBI-ProteinID: AEO75855
Position
3753210..3753767
AA seq 185 aa
MQDDDFSLFKSEMRGVKRISVDRADTGKPRNDRQQLKQRQLNASVRNDEIRVDGLSDQFV
IDVGPEDELSWARDGVQESQLRKLKQGLVPFDGSLDLHGMSVEKARQTLWDFLAEATRLE
IRCVRVTHGKAARKDGRSPLVKSHVNTWLRQHPQVLGFTSCLPRHGGTGSVYVMLRRTML
EGRDE
NT seq 558 nt   +upstreamnt  +downstreamnt
atgcaagacgacgacttttccctgttcaagagcgagatgcgcggcgtcaagcgcatctcg
gtcgatcgagccgataccggcaaacctcgcaacgaccgccagcaactcaagcagcgccag
ctcaatgccagcgtgcgcaacgacgaaatccgcgtcgatggcctgtccgaccagttcgtc
atcgacgtcggccccgaggacgagctgtcctgggcccgcgacggcgtccaggaaagccag
ttgcgcaagctcaagcagggcctggtgcccttcgacggtagcctcgacctgcacggcatg
agcgtggagaaggcccggcagacgctatgggacttccttgccgaggccacccgcctggaa
atccgctgcgtgcgcgtgacccatggcaaggccgcgcgcaaggacggacgcagcccgctg
gtgaaaagccacgtcaatacctggttgcgccagcacccgcaggtgctcggtttcacctcc
tgcctgccacgccacggcggcaccggctcggtctacgtgatgctgcgcaggaccatgctc
gaaggccgcgacgagtag

DBGET integrated database retrieval system