KEGG   Pseudomonas aeruginosa M18: PAM18_3374
Entry
PAM18_3374        CDS       T01973                                 

Definition
(GenBank) hypothetical protein
  KO
K07216  hemerythrin
Organism
paf  Pseudomonas aeruginosa M18
Brite
KEGG Orthology (KO) [BR:paf00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    PAM18_3374
SSDB
Motif
Pfam: Hemerythrin DUF3843
Other DBs
NCBI-ProteinID: AEO75857
Position
complement(3754455..3754916)
AA seq 153 aa
MAHLVWQDDLNTGIQVIDNQHKRIVEMINHLHDAQQGKEHAAIAEVIEELVDYTLSHFAF
EETLMEDAGYQFSRAHKKIHELFIRRVSEYRVRFQAGEDVGDELKGLLSRWLFNHIRNDD
AGYVDAVRHSMSELVKDKSEGGWLSRSMKRFFG
NT seq 462 nt   +upstreamnt  +downstreamnt
atggcgcatctggtctggcaggatgacctgaataccggtattcaggtcatcgacaatcaa
cacaaacgcatcgtcgagatgatcaatcacctgcacgacgcccagcaaggcaaggaacac
gcggcgatcgccgaggtgatcgaggagctggtggactacacgctgtcgcacttcgccttc
gaggaaaccctgatggaggacgccggctaccagttttcccgggcgcacaagaagatccac
gagctgttcatccgccgggtctccgaataccgggtgcgcttccaggccggcgaggatgtc
ggcgacgaactcaagggcttgctctcgcgctggctgttcaaccacatccgcaacgacgac
gccggatatgtggatgcggtacgccacagcatgtccgaactggtcaaggacaagagcgag
ggcggttggttgtcgcgctcgatgaagcgcttcttcggctga

DBGET integrated database retrieval system