KEGG   Pseudomonas aeruginosa M18: PAM18_3375
Entry
PAM18_3375        CDS       T01973                                 

Definition
(GenBank) putative enzyme
  KO
K06996  uncharacterized protein
Organism
paf  Pseudomonas aeruginosa M18
Brite
KEGG Orthology (KO) [BR:paf00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    PAM18_3375
SSDB
Motif
Pfam: Glyoxalase Glyoxalase_4 Glyoxalase_6
Other DBs
NCBI-ProteinID: AEO75858
Position
3755162..3755542
AA seq 126 aa
MNLIAHVEIPVSDLERAMRFYASVFGVAFGEVATLHGSRMAHFPFEEGRDGASGALAEGD
VYVPTLHGAIIYLNVADLDAVIARALGEGSEILFPKTPLGDGVFIAEIRDSEGNRIALQS
ACGERP
NT seq 381 nt   +upstreamnt  +downstreamnt
atgaacctgatcgcgcacgtggaaataccggtgtccgacctggagagggcgatgcgtttc
tacgcctcggtgttcggagtggcgttcggcgaggtagccaccctgcacggaagcagaatg
gcgcatttccccttcgaggaaggccgtgacggtgccagcggcgcactcgccgagggcgac
gtctacgtgcctacgctacatggggcgatcatctacctgaatgtcgcggacctggatgcc
gtcattgcccgggctctcggcgaaggcagcgaaatcctcttcccgaagacgccgcttggc
gacggcgtgttcatcgccgagatcagggacagcgaaggcaatcgtatcgccctgcagagc
gcttgcggagagcggccgtag

DBGET integrated database retrieval system